DEFB132 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DEFB132 Polyclonal antibody (33219-1-AP)

• 

  IP experiment of LNCaP using 33219-1-AP

  IP result of anti-DEFB132 (IP:33219-1-AP, 4ug; Detection:33219-1-AP 1:500) with LNCaP cells lysate 880 ug.

• 

  IP experiment of LNCaP using 33219-1-AP

  IP result of anti-DEFB132 (IP:33219-1-AP, 4ug; Detection:33219-1-AP 1:500) with LNCaP cells lysate 880 ug.

• 

  IHC staining of human urothelial carcinoma using 33219-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 33219-1-AP (DEFB132 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

DEFB132 Polyclonal Antibody for IHC, IP, ELISA

Cat No. 33219-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IP, ELISA

Synonyms

BD-32, Beta-defensin 132, Beta-defensin 32, DEFB32, DEFB-32

---

Tested Applications

• Positive IP detected in: LNCaP cells
• Positive IHC detected in: human urothelial carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33219-1-AP targets DEFB132 in IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37893

  Product name: Recombinant human DEFB132 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-95 aa of BC137293

  Sequence: GGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS

• Full Name: defensin, beta 132
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC137293
• Gene Symbol: DEFB132
• Gene ID (NCBI): 400830
• RRID: AB_3742901
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z7B7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human DEFB132 (Defensin Beta 132) is a member of the beta-defensin family and functions as a secreted antimicrobial peptide. This protein is highly expressed in epididymal epithelial cells and sperm, regulated by the androgen receptor signaling pathway, and serves as a key effector molecule of innate immunity in the male reproductive tract. DEFB132 exhibits broad-spectrum antimicrobial activity, inhibiting both Gram-negative bacteria such as *Escherichia coli* and Gram-positive bacteria such as *Staphylococcus aureus*, exerting its bactericidal function by disrupting the cell membranes of pathogens. As an inducible immune effector molecule, it plays multiple biological roles in host defense, reproductive health, and metabolic homeostasis.