DENND4A Polyclonal antibody

• 

  WB analysis using 26659-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26659-1-AP (DENND4A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

DENND4A Polyclonal Antibody for WB, ELISA

Cat No. 26659-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

MYCPBP, KIAA0476, IRLB, DENN/MADD domain containing 4A, C myc promoter binding protein

---

Tested Applications

• Positive WB detected in: HEK-293 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26659-1-AP targets DENND4A in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24568

  Product name: Recombinant human DENND4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1478-1634 aa of BC041706

  Sequence: TTCPFCGNIFLPFLNIEIRDLRRPGRYFLKSSPSTENMHFPSSISSQTRQSCISTSASGLDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGLEWHLPSPDPVT

• Full Name: DENN/MADD domain containing 4A
• Observed Molecular Weight: 230 kDa
• GenBank Accession Number: BC041706
• Gene Symbol: DENND4A
• Gene ID (NCBI): 10260
• RRID: AB_3669559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z401
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DENND4A (DENN domain-containing protein 4A), also called IRLB and MYCPBP, is a probable guanine nucleotide exchange factor (GEF) that may activate RAB10. It can promote the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. It may bind to the ISRE-like element (interferon-stimulated response element) of the MYC P2 promoter (PMID: 20937701; 8056341).