DGAT2 Recombinant monoclonal antibody, PBS Only (Capture)

DGAT2 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83262-2-PBS
Clone No.240171C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

240171C6, Acyl-CoA retinol O-fatty-acyltransferase, ARAT, Diacylglycerol O-acyltransferase 2, Diglyceride acyltransferase 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83262-2-PBS targets DGAT2 as part of a matched antibody pair:

MP00252-1: 83262-2-PBS capture and 83262-1-PBS detection (validated in Cytometric bead array)

MP00252-2: 83262-2-PBS capture and 83262-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10719

Product name: Recombinant human DGAT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 113-388 aa of BC015234

Sequence: DWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN

Predict reactive species
Full Name diacylglycerol O-acyltransferase homolog 2 (mouse)
Calculated Molecular Weight 388 aa, 44 kDa
GenBank Accession NumberBC015234
Gene Symbol DGAT2
Gene ID (NCBI) 84649
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96PD7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Diacylglycerol acyltransferase 2 (DGAT2) is an integral membrane protein and major enzyme that catalyzes the final step of triacylglycerol (TG) synthesis in eukaryotes (PMID: 21680734). DGAT2 is present in mitochondria-associated membranes, specialized domains of the ER that are highly enriched in lipid synthetic enzymes (PMID: 19049983). DGAT2 isoforms (39 kDa, 44kDa) have major differences in acyl-CoA substrate specificity toward erucoyl-CoA.

Loading...
||
New chat

Able

正在加载,请稍候...