Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24320-1-AP targets DGKB in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19809 Product name: Recombinant human DGKB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 30-140 aa of BC105005 Sequence: KDVLEEFHGNGVLAKYNPEGKQDILNQTIDFEGFKLFMKTFLEAELPDDFTAHLFMSFSNKFPHSSPMVKSKPALLSGGLRMNKGAITPPRTTSPANTCSPEVIHLKDIVC Predict reactive species |
| Full Name | diacylglycerol kinase, beta 90kDa |
| Calculated Molecular Weight | 804 aa, 91 kDa |
| Observed Molecular Weight | 91 kDa |
| GenBank Accession Number | BC105005 |
| Gene Symbol | DGKB |
| Gene ID (NCBI) | 1607 |
| RRID | AB_2879492 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y6T7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DGKB(Diacylglycerol kinase beta) is also named as DAGK2, KIAA0718 , 90 kDa diacylglycerol kinase and belongs to the eukaryotic diacetylglycerol kinase family. It is a key enzyme in lipid metabolism that functions to reintroduce diacylglycerol formed from the hydrolysis of phospholipids into the biosynthetic pathway. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 87 kDa and 91 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DGKB antibody 24320-1-AP | Download protocol |
| WB protocol for DGKB antibody 24320-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DGKB Polyclonal antibody (Cat# 24320-1-AP) has 1 total citation. It appears in Mutation Research (2025), where it was used in Western blot to study how DGKβ drives cervical cancer progression via ANGPT4-mediated tumor angiogenesis. The associated research field is cancer biology, specifically cervical carcinogenesis and tumor angiogenesis.
| Species | Application | Title |
|---|---|---|
Mutat Res DGKβ accelerates the progression of cervical cancer through ANGPT4-mediated tumor angiogenesis.
|
Reviews
What customers say
Both reviewers used this antibody for Western Blot at a 1:1000 dilution on melanoma cell lines. One reviewer praised it for consistently delivering high-quality, specific signals with minimal background. The other noted it was useful for validating DGK isoform expression in NRAS mutant melanoma, though some non-specific bands appeared in a few cell lines, likely attributable to low target expression. Overall, the antibody is well-regarded for specificity and signal quality in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kristen (Verified Customer) (12-02-2025) | Used to validate DGK isoform expression in NRAS mutant melanoma. Non-specific bands observed in a few cell lines, likely due to low expression
|
Haley (Verified Customer) (11-25-2025) | This antibody consistently delivers high-quality, specific signals with minimal background.
|
