DGKE Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DGKE Polyclonal antibody, PBS Only (11900-1-PBS)

• 

  WB analysis using 11900-1-AP (same clone as 11900-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11900-1-AP (DGKE antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11900-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 11900-1-AP (same clone as 11900-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11900-1-AP (DGKE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11900-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 11900-1-AP (same clone as 11900-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11900-1-AP (DGKE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11900-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 11900-1-AP (same clone as 11900-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11900-1-AP (DGKE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11900-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 11900-1-AP (same clone as 11900-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using DGKE antibody (11900-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11900-1-PBS in a different storage buffer formulation.

DGKE Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11900-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

11900-1-PBS targets DGKE in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2512

  Product name: Recombinant human DGKE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-177 aa of BC022297

  Sequence: MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRYGLRGHSLSQNAPWESGFHRVV

• Full Name: diacylglycerol kinase, epsilon 64kDa
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 60-64 kDa
• GenBank Accession Number: BC022297
• Gene Symbol: DGKE
• Gene ID (NCBI): 8526
• RRID: AB_2091145
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52429
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DGKE(Diacylglycerol kinase epsilon) is also named as DAGK5 and belongs to the eukaryotic diacylglycerol kinase family.It may be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction(PMID:16689942).When expressed in mammalian cells, DGK-epsilon showed specificity for arachidonyl-containing diacylglycerol.