DGKZ Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84830-5-RR (same clone as 84830-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84830-5-RR (DGKZ antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84830-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84830-5-RR (same clone as 84830-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84830-5-RR (DGKZ antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84830-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84830-5-RR (same clone as 84830-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84830-5-RR (DGKZ antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84830-5-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 84830-5-RR (same clone as 84830-5-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 84830-5-RR (DGKZ antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84830-5-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 84830-5-RR (same clone as 84830-5-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 84830-5-RR (DGKZ antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84830-5-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 84830-5-RR (same clone as 84830-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using DGKZ antibody (84830-5-RR, Clone: 241444A2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84830-5-PBS in a different storage buffer formulation.

DGKZ Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84830-5-PBS

Clone No.241444A2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

241444A2, DAG kinase zeta, DAGK5, DAGK6, DGK ZETA

---

Product Information

84830-5-PBS targets DGKZ in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag37336

  Product name: Recombinant human DGKZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 750-982 aa of NM_001199267.1

  Sequence: LDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV

• Full Name: diacylglycerol kinase, zeta 104kDa
• Calculated Molecular Weight: 104kDa，928aa
• Observed Molecular Weight: 104-124 kDa
• GenBank Accession Number: NM_001199267.1
• Gene Symbol: DGKZ
• Gene ID (NCBI): 8525
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q13574
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Diacylglycerol kinase zeta (DGKZ), also known as DAGK5, DAGK6, DGK-ZETA, hDGKzeta, belongs to the diacylglycerol kinase (DGK) family which catalyzes diacylglycerol (DAG) into phosphatidic acid (PA). DGKZ is a novel promoter of metastasis and that it could be a potential prognostic indicator in patients with triple-negative breast cancer by suppressing lipid raft-dependent endocytosis of TGFbetaR2(PMID: 35115500). Downregulation of DGKZ suppresses tumorigenesis and progression of cervical cancer by facilitating cell apoptosis and cell cycle arrest(PMID: 33926342).