DHRS4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DHRS4 Polyclonal antibody, PBS Only (15279-1-PBS)

• 

  WB analysis of rat liver using 15279-1-AP (same clone as 15279-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 15279-1-AP (DHRS4 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15279-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15279-1-AP (same clone as 15279-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15279-1-AP (DHRS4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15279-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 15279-1-AP (same clone as 15279-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15279-1-AP (DHRS4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15279-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15279-1-AP (same clone as 15279-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15279-1-AP (DHRS4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15279-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 15279-1-AP (same clone as 15279-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15279-1-AP (DHRS4 antibody) at dilution of 1:1000 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 15279-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 15279-1-AP (same clone as 15279-1-PBS)

  IP result of anti-DHRS4 (IP:15279-1-AP, 4ug; Detection:15279-1-AP 1:400) with mouse liver tissue lysate 4000ug. This data was developed using the same antibody clone with 15279-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 15279-1-AP (same clone as 15279-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 15279-1-AP (DHRS4 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15279-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 15279-1-AP (same clone as 15279-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 15279-1-AP (DHRS4 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15279-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervix using 15279-1-AP (same clone as 15279-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervix using 15279-1-AP (DHRS4 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15279-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervix using 15279-1-AP (same clone as 15279-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervix using 15279-1-AP (DHRS4 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15279-1-PBS in a different storage buffer formulation.

DHRS4 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 15279-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

15279-1-PBS targets DHRS4 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7398

  Product name: Recombinant human DHRS4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-278 aa of BC003019

  Sequence: MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL

• Full Name: dehydrogenase/reductase (SDR family) member 4
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC003019
• Gene Symbol: DHRS4
• Gene ID (NCBI): 10901
• RRID: AB_2292856
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BTZ2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DHRS4(Dehydrogenase/reductase SDR family member 4) is also named as PHCR , NRDR ,PSCD , SCAD-SRL, and belongs to the short-chain dehydrogenases/reductases (SDR) family. It can also catalyze the oxidation of all-trans-retinol with NADP as co-factor, but with much lower efficiency. Human DHRS4 is a tetramer composed of 27 kDa subunits, which is inactivated at low temperature without dissociation into subunits(PMID:18571493).