DHTKD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DHTKD1 Polyclonal antibody (27493-1-AP)

DHTKD1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27493-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

2-oxoadipate dehydrogenase complex component E1, 2-oxoadipate dehydrogenase, mitochondrial, Alpha-KADH-E1, Alpha-ketoadipate dehydrogenase, Dehydrogenase E1 and transketolase domain-containing protein 1

• 

  WB analysis using 27493-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27493-1-AP (DHTKD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27493-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27493-1-AP (DHTKD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-13 using 27493-1-AP

  PC-13 cells were subjected to SDS PAGE followed by western blot with 27493-1-AP (DHTKD1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 27493-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27493-1-AP (DHTKD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 27493-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27493-1-AP (DHTKD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 27493-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 27493-1-AP (DHTKD1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human rectal cancer using 27493-1-AP

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 27493-1-AP (DHTKD1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27493-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27493-1-AP (DHTKD1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human rectal cancer using 27493-1-AP

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 27493-1-AP (DHTKD1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 27493-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using DHTKD1 antibody (27493-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HepG2 cells, PC-13 cells, L02 cells, mouse kidney tissue, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27493-1-AP targets DHTKD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26515

  Product name: Recombinant human DHTKD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-197 aa of BC007955

  Sequence: GYRPRKPESREPQGALERPPVDHGLARLVTVYCEHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGLLNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLATKFSTVKRYGGEGAES

• Full Name: dehydrogenase E1 and transketolase domain containing 1
• Calculated Molecular Weight: 103 kDa
• Observed Molecular Weight: 103 kDa
• GenBank Accession Number: BC007955
• Gene Symbol: DHTKD1
• Gene ID (NCBI): 55526
• RRID: AB_2880888
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96HY7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DHTKD1 (Dehydrogenase E1 And Transketolase Domain Containing 1)

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; AKT1 glutarylation regulated by GCDH and SIRT5 suppresses oncogenic signaling.; Authors - Longchang Bai
human	WB	Front Endocrinol (Lausanne); Knock-Out of DHTKD1 Alters Mitochondrial Respiration and Function, and May Represent a Novel Pathway in Cardiometabolic Disease Risk.; Authors - Chuan Wang
mouse	WB,IHC	J Hepatocell Carcinoma; Liver Regeneration-Related Genes of Nontumor Liver Tissues Predict the Prognosis of Patients with Hepatocellular Carcinoma; Authors - Yanchao Xu