DHTKD1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• DHTKD1 Recombinant monoclonal antibody (86661-3-RR)

• 

  WB analysis using 86661-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86661-3-RR (DHTKD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86661-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86661-3-RR against Human DHTKD1 were performed. The affinity constant is 1.99 nM.

DHTKD1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86661-3-RR

Clone No.251575H1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

2-oxoadipate dehydrogenase complex component E1, 2-oxoadipate dehydrogenase, mitochondrial, Alpha-KADH-E1, Alpha-ketoadipate dehydrogenase, Dehydrogenase E1 and transketolase domain-containing protein 1

---

Tested Applications

• Positive WB detected in: L02 cells, MCF-7 cells, HepG2 cells, mouse liver tissue, mouse kidney tissue, rat kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86661-3-RR targets DHTKD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26515

  Product name: Recombinant human DHTKD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-197 aa of BC007955

  Sequence: GYRPRKPESREPQGALERPPVDHGLARLVTVYCEHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGLLNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLATKFSTVKRYGGEGAES

• Full Name: dehydrogenase E1 and transketolase domain containing 1
• Calculated Molecular Weight: 103 kDa
• Observed Molecular Weight: 103 kDa
• GenBank Accession Number: BC007955
• Gene Symbol: DHTKD1
• Gene ID (NCBI): 55526
• RRID: AB_3745037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96HY7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DHTKD1 (Dehydrogenase E1 And Transketolase Domain Containing 1), also named as 2-aminoadipic 2-oxoadipic aciduria protein, OADC-E1, OADH-E1, is a lesser-studied E1 enzyme among the family of 2-oxoacid dehydrogenases (PMID: 32695416). DHTKD1 was expressed ubiquitously in various tissues and was proposed to localize to the mitochondria (PMID: 23141294). DHTKD1 plays a critical role in energy production in mitochondria, suppression of DHTKD1 leads to impaired mitochondrial biogenesis and increased cell apoptosis (PMID: 24076469).