DHX15 Polyclonal antibody

• 

  WB analysis using 12265-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12265-1-AP (DHX15 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 12265-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12265-1-AP (DHX15 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12265-1-AP

  WB result of DHX15 antibody (12265-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DHX15 transfected HeLa cells.

• 

  WB analysis of NIH/3T3 using 12265-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 12265-1-AP (DHX15 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of NIH/3T3 using 12265-1-AP

  IP result of anti-DHX15 (IP:12265-1-AP, 4ug; Detection:12265-1-AP 1:600) with NIH/3T3 cells lysate 2000ug.

• 

  IHC staining of mouse testis using 12265-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 12265-1-AP (DHX15 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 12265-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 12265-1-AP (DHX15 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

DHX15 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12265-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

ATP-dependent RNA helicase #46, ATP-dependent RNA helicase DHX15, DBP1, DDX15, EC:3.6.4.13

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, NIH/3T3 cells
• Positive IP detected in: NIH/3T3 cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below

Product Information

12265-1-AP targets DHX15 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2895

  Product name: Recombinant human DHX15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 147-517 aa of BC035974

  Sequence: TDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKL

• Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 15
• Calculated Molecular Weight: 795 aa, 91 kDa
• Observed Molecular Weight: 91 kDa
• GenBank Accession Number: BC035974
• Gene Symbol: DHX15
• Gene ID (NCBI): 1665
• RRID: AB_908769
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43143
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DHX15, also named as DBP1 and DDX15, is a DExD/H-box protein that has been identified in spliceosome, through its carboxyl (C)-terminal G-patch domain and stimulates the helicase activity of DHX15. DHX15 is a Pre-mRNA processing factor involved in disassembly of spliceosomes after the release of mature mRNA. The MW of DHX15 is about 90-95kd.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IHC	Nat Commun; Fusobacterium nucleatum promotes tumor progression in KRAS p.G12D-mutant colorectal cancer by binding to DHX15; Authors - Huiyuan Zhu
zebrafish	WB	Cancer Sci; Dhx15 regulates zebrafish definitive hematopoiesis through the unfolded protein response pathway.; Authors - Yuanhua Cai
human	WB	J Cell Mol Med; ETS1 and SP1 drive DHX15 expression in acute lymphoblastic leukaemia.; Authors - Xiang-Lei Chen
human	WB	FEBS Lett; Tumor suppressor RBM5 directly interacts with the DExD/H-box protein DHX15 and stimulates its helicase activity.; Authors - Niu Zhaoyang Z
human	WB	RNA; A model for DHX15 mediated disassembly of A-complex spliceosomes; Authors - Hannah M Maul-Newby
		PLoS Pathog; Downregulation of CPSF6 Leads to Global mRNA 3' UTR shortening and enhanced antiviral immune responses; Authors - Yong Ge