• Featured Product
  • KD/KO Validated

DHX15 Recombinant monoclonal antibody

DHX15 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 82137-1-RR
Clone No.1F13

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

1F13, ATP-dependent RNA helicase #46, ATP-dependent RNA helicase DHX15, DBP1, DDX15

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU-251 cells, HeLa cells, U2OS cells, A431 cells, NIH/3T3 cells, C6 cells
Positive IP detected inNIH/3T3 cells
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82137-1-RR targets DHX15 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2895

Product name: Recombinant human DHX15 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 147-517 aa of BC035974

Sequence: TDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKL

Predict reactive species
Full Name DEAH (Asp-Glu-Ala-His) box polypeptide 15
Calculated Molecular Weight 795 aa, 91 kDa
Observed Molecular Weight90-95 kDa
GenBank Accession NumberBC035974
Gene Symbol DHX15
Gene ID (NCBI) 1665
RRIDAB_3086467
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43143
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DHX15, also named as DBP1 and DDX15, is a DExD/H-box protein that has been identified in spliceosome, through its carboxyl (C)-terminal G-patch domain and stimulates the helicase activity of DHX15. DHX15 is a pre-mRNA processing factor involved in disassembly of spliceosomes after the release of mature mRNA. The MW of DHX15 is about 90-95kDa.

Protocols

Product Specific Protocols
FC protocol for DHX15 antibody 82137-1-RRDownload protocol
IF protocol for DHX15 antibody 82137-1-RRDownload protocol
IHC protocol for DHX15 antibody 82137-1-RRDownload protocol
IP protocol for DHX15 antibody 82137-1-RRDownload protocol
WB protocol for DHX15 antibody 82137-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Aleksandr (Verified Customer) (12-16-2024)

Great antibody for Dhx15 detection! On the picture, red asterisk indicates the non-specific band that comes from the previous round of staining with another antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: RKO
DHX15 Antibody Western Blot validation (1:10000 dilution) in RKO (Cat no:82137-1-RR)
FH

Tsimafei (Verified Customer) (08-12-2024)

Excellent and sensitive antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: mESCs
DHX15 Antibody Western Blot validation (1:10000 dilution) in mESCs (Cat no:82137-1-RR)
Loading...
||
New chat Able
正在加载,请稍候...