Use Able AI chat for product recommendations

Smac/DIABLO Monoclonal antibody, PBS Only (Detector)

Smac/DIABLO Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 68480-1-PBS
Clone No.2F12C9

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

DIABLO, 2F12C9, DFNA64, Diablo homolog, mitochondrial, Diablo IAP-binding mitochondrial protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68480-1-PBS targets Smac/DIABLO as part of a matched antibody pair:

MP50334-2: 68480-4-PBS capture and 68480-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag32774

Product name: Recombinant human DIABLO protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-239 aa of BC011909

Sequence: MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Predict reactive species
Full Name diablo homolog (Drosophila)
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC011909
Gene Symbol DIABLO
Gene ID (NCBI) 56616
RRIDAB_3085191
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NR28
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Smac/DIABLO is a mitochondrial protein that promotes apoptosis by neutralizing members of the IAP family. SMAC/DIABLO is ubiquitously expressed in normal tissues, and the expression of SMAC messenger RNA (mRNA) in adult testis is the highest .Smac/DIABLO encodes a 239 amino acid protein (~27 kDa). The first 55 amino acids are a mitochondrial targeting signal peptide that is cleaved to generate mature Smac-DIABLO (~21 kDa). When released from mitochondria, Smac-DIABLO acts as a natural antagonist of inhibitor of apoptosis proteins (IAPs). Smac-DIABLO antagonistic activity is based on its N-terminal tetrapeptide (AVPI) that binds baculoviral IAP repeat (BIR) domains of IAPs, releasing their inhibitory effects on both initiator and effector caspases, thus promoting cell death. (PMID: 32325691, PMID: 32575872,PMID: 25650938)

Loading...
||
New chat

Able

正在加载,请稍候...