Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, MCF-7 cells |
| Positive IHC detected in | human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26513-1-AP targets DIO2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24119 Product name: Recombinant human DIO2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 171-273 aa of BC074882 Sequence: AIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG Predict reactive species |
| Full Name | deiodinase, iodothyronine, type II |
| Calculated Molecular Weight | 273 aa, 31 kDa |
| Observed Molecular Weight | 35-40 kDa |
| GenBank Accession Number | BC074882 |
| Gene Symbol | DIO2 |
| Gene ID (NCBI) | 1734 |
| RRID | AB_2880538 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92813 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Type II iodothyronine deiodinase(DIO2), belongs to the iodothyronine deiodinase family, with two isoform of 30 and 34 kDa. DIO2 can activates thyroid hormone by converting the prohormone thyroxine (T4) by outer ring deiodination (ORD) to bioactive 3,3',5-triiodothyronine (T3). DIO2 is thought to be responsible for the 'local' production of T3, and thus important in influencing thyroid hormone action in these tissues.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DIO2 antibody 26513-1-AP | Download protocol |
| IHC protocol for DIO2 antibody 26513-1-AP | Download protocol |
| WB protocol for DIO2 antibody 26513-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-UCP1 antibody (Cat# 26513-1-AP) has 22 total citations published across 20 journals, including Nature Communications, Molecular Cell, Nature Chemical Biology, Advanced Science, Cell Reports Medicine, Diabetes, FASEB Journal, and Endocrinology. Associated research fields encompass adipose tissue thermogenesis and browning, ferroptosis, cancer biology, thyroid/endocrine regulation, pulmonary disease, obesity, and metabolic homeostasis. Applications are predominantly Western blotting, with several immunohistochemistry studies.
| Species | Application | Title |
|---|---|---|
Nat Commun Multi-layered transcriptional control of glycogen metabolism coordinates thermogenic remodeling of white adipocytes in male mice. | ||
Mol Cell Hypoxia-driven lncRNA SHIELD promotes GPX4 translation and protects against ferroptosis in hepatocellular carcinoma. | ||
Nat Chem Biol Ribosome stalling during selenoprotein translation exposes a ferroptosis vulnerability. | ||
Adv Sci (Weinh) Tumor Cell "Slimming" Regulates Tumor Progression through PLCL1/UCP1-Mediated Lipid Browning. | ||
Cell Rep Med Dysregulated Gln-Glu-α-ketoglutarate axis impairs maternal decidualization and increases the risk of recurrent spontaneous miscarriage | ||
Cell Commun Signal Interleukin 27-induced photoreceptor survival is associated with suppression of a novel Muller glia subpopulation. |
