ARHI Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ARHI Polyclonal antibody (10811-2-AP)

ARHI Polyclonal Antibody for IHC, ELISA

Cat No. 10811-2-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ARHI, DIRAS3, GTP binding protein Di Ras3, NOEY2, RHOI

• 

  WB analysis using 10811-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10811-2-AP (ARHI antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 10811-2-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 10811-2-AP (ARHI antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 10811-2-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 10811-2-AP (ARHI antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ARHI in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10811-2-AP targets ARHI in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1123

  Product name: Recombinant human DIRAS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-229 aa of BC005362

  Sequence: MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM

• Full Name: DIRAS family, GTP-binding RAS-like 3
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC005362
• Gene Symbol: ARHI
• Gene ID (NCBI): 9077
• RRID: AB_2292774
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95661
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ARHI Polyclonal antibody (Cat# 10811-2-AP) has 1 total citation. It was cited in International Journal of Biological Macromolecules (IF 8.7, 2024), in a study investigating how Schizophyllum commune fruiting body polysaccharides inhibit glioma through ARHI-mediated regulation of the PI3K/AKT signaling pathway. The research field is cancer biology, specifically glioma and signal transduction. The antibody was used for WB and IHC applications in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Int J Biol Macromol; Schizophyllum commune fruiting body polysaccharides inhibit glioma by mediating ARHI regulation of PI3K/AKT signalling pathway; Authors - Shi-Xing Zheng