DIS3 Polyclonal antibody

DIS3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29664-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

DIS 3, Dis-3, dis3p, EC:3.1.13.-, EXOSC11

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis using 29664-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 29664-1-AP (DIS3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 29664-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse testis using 29664-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse testis using 29664-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse testis using 29664-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 29664-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 29664-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 29664-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 29664-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 29664-1-AP
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DIS3 antibody (29664-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidine (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DIS3 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293T cells, HeLa cells, HepG2 cells, Jurkat cells, MCF-7 cells
Positive IHC detected in	human colon cancer tissue, human ovary tumor tissue, mouse testis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29664-1-AP targets DIS3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag31711 Product name: Recombinant human DIS3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 607-958 aa of NM_014953 Sequence: TTSLRGLNKLAKILKKRRIEKGALTLSSPEVRFHMDSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYEILVKAARSRNLEIKTDTAKSLAESLDQAESPTFPYLNTLLRILATRCMMQAVYFCSGMDNDFHHYGLASPIYTHFTSPIRRYADVIVHRLLAVAIGADCTYPELTDKHKLADICKNLNFRHKMAQYAQRASVAFHTQLFFKSKGIVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKLGK Predict reactive species
Full Name	DIS3 mitotic control homolog (S. cerevisiae)
Calculated Molecular Weight	109KD
Observed Molecular Weight	110 kDa
GenBank Accession Number	NM_014953
Gene Symbol	DIS3
Gene ID (NCBI)	22894
RRID	AB_2918336
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9Y2L1
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DIS3, also named as KIAA1008 and RRP44, belongs to the ribonuclease II (RNB) family. It is a component of the exosome 3'->5' exoribonuclease complex. DIS3 is required for the 3'-processing of the 7S pre-RNA to the mature nuclear complex. It is also associated with the GTPase Ran. DIS3 has a 3'-5' exonuclease activity.

Protocols

Product Specific Protocols
IF protocol for DIS3 antibody 29664-1-AP	Download protocol
IHC protocol for DIS3 antibody 29664-1-AP	Download protocol
WB protocol for DIS3 antibody 29664-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The DIS3 polyclonal antibody (Cat# 29664-1-AP) has 1 citation. It appears in iScience (2024), in a study investigating PABPC1-mediated degradation of C9orf72-FTLD/ALS GGGGCC repeat RNA. The research field encompasses neurodegenerative disease (frontotemporal lobar degeneration and amyotrophic lateral sclerosis) and RNA biology, specifically exosome complex function in repeat RNA processing.