DIS3L2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67623-1-Ig (same clone as 67623-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67623-1-Ig (DIS3L2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 67623-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67623-1-Ig (same clone as 67623-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67623-1-Ig (DIS3L2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 67623-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Jurkat using 67623-1-Ig (same clone as 67623-1-PBS)

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug DIS3L2 Monoclonal antibody (67623-1-Ig, Clone:2C9F2) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 67623-1-PBS in a different storage buffer formulation.

DIS3L2 Monoclonal Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 67623-1-PBS

Clone No.2C9F2

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

DIS3 like exonuclease 2, DIS3-like exonuclease 2, EC:3.1.13.-, FAM6A, hDIS3L2

---

Product Information

67623-1-PBS targets DIS3L2 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29992

  Product name: Recombinant human DIS3L2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-170 aa of BC030113

  Sequence: AGALGYRERLDMAPDTLQKQADHCNDSRMASKRVQELSTSLFFAVLVKESGPLESEAMVMGILKQAFDVLVLRYGVQKRIYCNALALRSHHFQKVGKKPELTLVWEPEDMEQEPAQQVITIFSLVEVVLQAEYTALKYSAILKRPGTQGHLGPEKEEEESDGEPEDSSTS

• Full Name: DIS3 mitotic control homolog (S. cerevisiae)-like 2
• Calculated Molecular Weight: 885 aa, 99 kDa
• Observed Molecular Weight: 65 kDa, 99 kda
• GenBank Accession Number: BC030113
• Gene Symbol: DIS3L2
• Gene ID (NCBI): 129563
• RRID: AB_2882825
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IYB7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DIS3L2 encodes a protein of 885 amino acids with a predicted molecular weight of 99.3 kDa.