DKK1 Recombinant monoclonal antibody

• 

  WB analysis using 86207-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86207-1-RR (DKK1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

DKK1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86207-1-RR

Clone No.250658B2

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

Dickkopf-1, Dickkopf-related protein 1, DKK 1, Dkk-1, hDkk 1

---

Tested Applications

• Positive WB detected in: Neuro-2a cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86207-1-RR targets DKK1 in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4649

  Product name: Recombinant Mouse DKK1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 32-272 aa of NM_010051.3

  Sequence: TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH

• Full Name: dickkopf homolog 1 (Xenopus laevis)
• Calculated Molecular Weight: 29kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: NM_010051.3
• Gene Symbol: Dkk1
• Gene ID (NCBI): 13380
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O54908
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DKK1, also named a SK and Dickkopf-1, belongs to the dickkopf family. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. SDS-PAGE and Western blot analysis demonstrated that DKK1 is expressed as a 35-kDa doublet protein, which is larger than the deduced molecular mass of 26 kDa. Sometime DKK1 is expressed as a 42- to 50-kDa secreted protein, with little change observed after glycanase treatment.