DLC1 Polyclonal antibody

• 

  IP experiment of mouse lung using 15460-1-AP

  IP result of anti-DLC1 (IP:15460-1-AP, 4ug; Detection:15460-1-AP 1:300) with mouse lung tissue lysate 2400ug.

• 

  IHC staining of human spleen using 15460-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 15460-1-AP (DLC1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human spleen using 15460-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 15460-1-AP (DLC1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human liver using 15460-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15460-1-AP (DLC1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver using 15460-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15460-1-AP (DLC1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HepG2 using 15460-1-AP

  Immunofluorescent analysis of HepG2 cells, using DLC1 antibody 15460-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

DLC1 Polyclonal Antibody for IHC, IF/ICC, IP, ELISA

Cat No. 15460-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

HP protein, HP, DLC-1, DLC 1, deleted in liver cancer 1

---

Tested Applications

• Positive IP detected in: mouse lung tissue
• Positive IHC detected in: human spleen tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

15460-1-AP targets DLC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7732

  Product name: Recombinant human DLC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1179-1528 aa of BC054511

  Sequence: KDQRLQAIKAAIMLLPDENREVLQTLLYFLSDVTAAVKENQMTPTNLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGLAHMIAECKKLFQVPEEMSRCRNSYTEQELKPLTLEALGHLGNDDSADYQHFLQDCVDGLFKEVKEKFKGWVSYSTSEQAELSYKKVSEGPPLRLWRSVIEVPAVPEEILKRLLKEQHLWDVDLLDSKVIEILDSQTEIYQYVQNSMAPHPARDYVVLRTWRTNLPKGACALLLTSVDHDRAPVVGVRVNVLLSRYLIEPCGPGKSKLTYMCRVDLRGHMPEWYTKSFGHLCAAEVVKIRDSFSNQNTETKDTKSR

• Full Name: deleted in liver cancer 1
• Calculated Molecular Weight: 171 kDa
• GenBank Accession Number: BC054511
• Gene Symbol: DLC1
• Gene ID (NCBI): 10395
• RRID: AB_2246077
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96QB1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biomaterials; Stiffness assisted cell-matrix remodeling trigger 3D mechanotransduction regulatory programs; Authors - Anna L Kersey
human	IF	Cancer Res; Mutant KRAS and CK2 Cooperatively Stimulate SLC16A3 Activity to Drive Intrahepatic Cholangiocarcinoma Progression; Authors - Ran Chen
rat	WB,IHC	J Sex Med; Hypoandrogenic state inhibits erectile function in rats via miR-200a-3p; Authors - Yuan Wang