DLG5 Polyclonal antibody

DLG5 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 15687-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Placenta and prostate DLG, PDLG, KIAA0583, Disks large homolog 5, Discs large protein P-dlg

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-3 cells, mouse kidney tissue, HeLa cells
Positive IHC detected inHuman bowens disease
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

15687-1-AP targets DLG5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8194

Product name: Recombinant human DLG5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1569-1919 aa of BC002915

Sequence: VRNKTVEEVYVEMLKPRDGVRLKVQYRPEEFTKAKGLPGDSFYIRALYDRLADVEQELSFKKDDILYVDDTLPQGTFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSRRLSMSEVKDDNSATKTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSSDSIPLFEDSVSLAYQRVQKVDCTALRPVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGRCAWAWSGEQAAGKEAEAS

Predict reactive species
Full Name discs, large homolog 5 (Drosophila)
Calculated Molecular Weight 1893 aa, 209 kDa
Observed Molecular Weight 75 kDa, 240 kDa
GenBank Accession NumberBC002915
Gene Symbol DLG5
Gene ID (NCBI) 9231
RRIDAB_10642568
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TDM6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Discs large homolog 5 (DLG5) belongs to the membrane-associated guanylate kinase (MAGUK) family. DLG5 participates in epithelial cell polarity maintenance and cancer development. DLG5 is highly expressed in normal tissues, but its expression is decreased in many cancers, such as bladder cancer, prostate cancer, breast cancer, and hepatocellular carcinoma (PMID: 32015336). Down-regulation of DLG5 is highly correlated with clinical tumor stage. In breast cancer, knockdown of DLG5 induces cell migration, and overexpression of DLG5 inhibits cell migration (PMID: 28169360). DLG5 has 3 isoforms with the molecular weight of 75, 214 and 240 kDa.

Protocols

Product Specific Protocols
IHC protocol for DLG5 antibody 15687-1-APDownload protocol
WB protocol for DLG5 antibody 15687-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Death Dis

PABPC1-induced stabilization of BDNF-AS inhibits malignant progression of glioblastoma cells through STAU1-mediated decay.

Authors - Rui Su

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Rebecca (Verified Customer) (10-25-2022)

20ug of protein were loaded. Transference was performed at 4ºC and 90V for 2h. Antibody incubation was done ON at 4ºC. I obtained several bands: around 105 kDa, 200 kDa and 240 kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: iPSC-CM
DLG5 Antibody Western Blot validation (1:1000 dilution) in iPSC-CM (Cat no:15687-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...