DLGAP1 Polyclonal antibody

• 

  WB analysis using 28124-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28124-1-AP (DLGAP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

DLGAP1 Polyclonal Antibody for WB, ELISA

Cat No. 28124-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

DAP 1, DAP 1 ALPHA, DAP 1 BETA, DAP1, DLGAP1, GKAP, hGKAP, PSD 95/SAP90 binding protein 1, SAPAP1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue, rat cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28124-1-AP targets DLGAP1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27182

  Product name: Recombinant human DLGAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 10-68 aa of BC070175

  Sequence: HHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASS

• Full Name: discs, large (Drosophila) homolog-associated protein 1
• Calculated Molecular Weight: 543 aa, 60 kDa
• Observed Molecular Weight: 110-130 kDa
• GenBank Accession Number: BC070175
• Gene Symbol: DLGAP1
• Gene ID (NCBI): 9229
• RRID: AB_3086030
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14490
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.