DLST Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DLST Polyclonal antibody (31174-1-AP)

• 

  WB analysis using 31174-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31174-1-AP (DLST antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 31174-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31174-1-AP (DLST antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 31174-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31174-1-AP (DLST antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 31174-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using DLST antibody (31174-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

DLST Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31174-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

DLTS, OGDC E2

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31174-1-AP targets DLST in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34753

  Product name: Recombinant human DLST protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 212-366 aa of BC001922

  Sequence: EPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDG

• Full Name: dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 40 kDa, 49 kDa
• GenBank Accession Number: BC001922
• Gene Symbol: DLST
• Gene ID (NCBI): 1743
• RRID: AB_3742403
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P36957
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DLST (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex) ) is the E2 transferase of α-ketoglutarate dehydrogenase complex (KGDHC) that regulates the irreversible conversion of α-ketoglutarate to succinyl-CoA in the TCA cycle.RNAi knockdown of DLST led to decreased cell viability and induction of apoptosis in human T-ALL cell lines. High DLST expression predicts poor overall and recurrencefree survival among TNBC patients (PMID: 26876595, 34785772). DLST has two isoforms of 40 kDa, 49 kDa.