Tested Applications
| Positive WB detected in | NIH/3T3 cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26244-1-AP targets DLX2 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24663 Product name: Recombinant human DLX2 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 240-328 aa of BC032558 Sequence: SWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTSGSASHLQATAPLLHPTQTPQPHHHHHHHGGGGAPVSAGTIF Predict reactive species |
| Full Name | distal-less homeobox 2 |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC032558 |
| Gene Symbol | DLX2 |
| Gene ID (NCBI) | 1746 |
| RRID | AB_2880444 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q07687 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DLX2, also named as Homeobox protein DLX-2, is a 328 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the distal-less homeobox family. DLX2 localizes in the nucleus and is a Phosphoprotein. DLX2 likely to play a regulatory role in the development of the ventral forebrain and may play a role in craniofacial patterning and morphogenesis. The calcualted molecular weight of DLX2 is 34 kDa, but modified DLX2 is about 45-50 kDa. (PMID: 14769946)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DLX2 antibody 26244-1-AP | Download protocol |
| WB protocol for DLX2 antibody 26244-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-DLX2 antibody (Cat# 26244-1-AP) has 7 citations published in journals including Cell Death & Disease, Cancer Letters, iScience, Frontiers in Oncology, PLoS ONE, Breast Journal, and bioRxiv. Research fields span bone biology/osteoporosis, esophageal carcinogenesis, osteosarcoma and gastric cancer EMT, interneuron specification, breast cancer risk genetics, and C. elegans neurodevelopment. Applications include WB, IHC, IF, and CoIP in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Cell Death Dis Mmu-miR-185 depletion promotes osteogenic differentiation and suppresses bone loss in osteoporosis through the Bgn-mediated BMP/Smad pathway. | ||
Cancer Lett Disruption of enhancer-driven S100A14 expression promotes esophageal carcinogenesis | ||
iScience DLX2 promotes osteosarcoma epithelial-mesenchymal transition and doxorubicin resistance by enhancing HOXC8-CDH2 axis | ||
Front Oncol DLX2 promotes gastric cancer epithelial- mesenchymal transition and malignant progression through the PI3K/AKT signaling pathway.
| ||
PLoS One Examining the role of the surfactant family member SFTA3 in interneuron specification. | ||
Breast J rs2357322 and rs17726078 Contribute to Breast Cancer Risk by Regulating DLX2 Expression. |
Reviews
What customers say
One reviewer (De Huang, 2019) rated this antibody 5/5 stars. Using lot 00047878 at a 1:1000 dilution for Western Blot on human A549, H1650, and mouse LLC cells, they reported that the antibody produced a clear and appropriately sized band on the WB membrane. Overall, the feedback is positive, confirming reliable performance in Western Blot applications across both human and mouse cell lines.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
De (Verified Customer) (08-21-2019) | It has a clear and right-size bind on WB membrane
|
