DLX2 Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 26244-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 26244-1-AP (DLX2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 26244-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26244-1-AP (DLX2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 26244-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26244-1-AP (DLX2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 26244-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed SH-SY5Y cells using 26244-1-AP (DLX2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

DLX2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26244-1-AP

Publications(4)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

distal less homeobox 2, DLX2, Homeobox protein DLX 2, TES 1, TES1

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 2 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

26244-1-AP targets DLX2 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24663

  Product name: Recombinant human DLX2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 240-328 aa of BC032558

  Sequence: SWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTSGSASHLQATAPLLHPTQTPQPHHHHHHHGGGGAPVSAGTIF

• Full Name: distal-less homeobox 2
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC032558
• Gene Symbol: DLX2
• Gene ID (NCBI): 1746
• RRID: AB_2880444
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q07687
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DLX2, also named as Homeobox protein DLX-2, is a 328 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the distal-less homeobox family. DLX2 localizes in the nucleus and is a Phosphoprotein. DLX2 likely to play a regulatory role in the development of the ventral forebrain and may play a role in craniofacial patterning and morphogenesis. The calcualted molecular weight of DLX2 is 34 kDa, but modified DLX2 is about 45-50 kDa. (PMID: 14769946)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,CoIP	iScience; DLX2 promotes osteosarcoma epithelial-mesenchymal transition and doxorubicin resistance by enhancing HOXC8-CDH2 axis; Authors - Boya Zhang
human	IF	PLoS One; Examining the role of the surfactant family member SFTA3 in interneuron specification.; Authors - Christopher Y Chen
mouse	WB	Cell Death Dis; Mmu-miR-185 depletion promotes osteogenic differentiation and suppresses bone loss in osteoporosis through the Bgn-mediated BMP/Smad pathway.; Authors - Qi Cui
human	IHC	Cancer Lett; Disruption of enhancer-driven S100A14 expression promotes esophageal carcinogenesis; Authors - Xukun Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

De (Verified Customer) (08-21-2019)

It has a clear and right-size bind on WB membrane

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: human A549, H1650; mouse LLC