DLX3 Monoclonal antibody

• 

  WB analysis using 67282-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67282-1-Ig (DLX3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 67282-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67282-1-Ig (DLX3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of JAR using 67282-1-Ig

  JAR cells were subjected to SDS PAGE followed by western blot with 67282-1-Ig (DLX3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NCCIT using 67282-1-Ig

  NCCIT cells were subjected to SDS PAGE followed by western blot with 67282-1-Ig (DLX3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

DLX3 Monoclonal Antibody for WB, ELISA

Cat No. 67282-1-Ig

Clone No.1H8E1

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, ELISA

Synonyms

TDO, Homeobox protein DLX-3, AI4, 1H8E1

---

Tested Applications

• Positive WB detected in: pig brain tissue, HEK-293 cells, JAR cells, NCCIT cells, rat brain tissue, mouse brain tissue, mouse cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67282-1-Ig targets DLX3 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29313

  Product name: Recombinant human DLX3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-287 aa of BC028970

  Sequence: MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY

• Full Name: distal-less homeobox 3
• Calculated Molecular Weight: 287 aa, 32 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC028970
• Gene Symbol: DLX3
• Gene ID (NCBI): 1747
• RRID: AB_2882549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60479
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.