DLX3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67282-1-Ig (same clone as 67282-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67282-1-Ig (DLX3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67282-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67282-1-Ig (same clone as 67282-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67282-1-Ig (DLX3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67282-1-PBS in a different storage buffer formulation.

• 

  WB analysis of JAR using 67282-1-Ig (same clone as 67282-1-PBS)

  JAR cells were subjected to SDS PAGE followed by western blot with 67282-1-Ig (DLX3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67282-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCCIT using 67282-1-Ig (same clone as 67282-1-PBS)

  NCCIT cells were subjected to SDS PAGE followed by western blot with 67282-1-Ig (DLX3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67282-1-PBS in a different storage buffer formulation.

DLX3 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67282-1-PBS

Clone No.1H8E1

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

Synonyms

TDO, Homeobox protein DLX-3, AI4, 1H8E1

---

Product Information

67282-1-PBS targets DLX3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29313

  Product name: Recombinant human DLX3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-287 aa of BC028970

  Sequence: MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY

• Full Name: distal-less homeobox 3
• Calculated Molecular Weight: 287 aa, 32 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC028970
• Gene Symbol: DLX3
• Gene ID (NCBI): 1747
• RRID: AB_2882549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60479
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.