Use Able AI chat for product recommendations

DLX5 Monoclonal antibody

DLX5 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67111-1-Ig
Clone No. 1C9G1
Publications (1)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

1C9G1, Homeobox protein DLX-5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for DLX5 in ?

Tested Applications

Positive WB detected inPC-12 cells, A375 cells, U-251 cells, THP-1 cells, pig brain tissue, rat brain tissue, mouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67111-1-Ig targets DLX5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17040

Product name: Recombinant human DLX5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-289 aa of BC006226

Sequence: MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY

Predict reactive species
Full Name distal-less homeobox 5
Calculated Molecular Weight 32 kDa
Observed Molecular Weight 33-38 kDa
GenBank Accession NumberBC006226
Gene Symbol DLX5
Gene ID (NCBI) 1749
RRIDAB_2882415
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP56178
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DLX5 belongs to the DLX family of homeobox transcription factors (Dlx1, Dlx2, Dlx5 and Dlx6), which is expressed in overlapping domains at different stages of cell differentiation in the subpallium and controls differentiation of GABAergic neurons. DLX5 is an immediate early BMP-responsive transcriptional activator that essential for osteoblast differentiation. It can bind to and stimulate the homeodomain-response element of the ALPL and SP7 promoter. DLX5 can form homodimer with DLX2(~34kd) and heterodimer with MSX2(~29kd).

Protocols

Product Specific Protocols
IHC protocol for DLX5 antibody 67111-1-IgDownload protocol
WB protocol for DLX5 antibody 67111-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The DLX5 Monoclonal antibody (1C9G1), catalog number 67111-1-Ig, has 1 total citation. It appears in Bioactive Materials (2025), where it was used in Western blot to study engineering fibroblasts with reprogramming and spheronization for bone defect repair. The research field is tissue engineering and regenerative medicine, specifically osteoblast differentiation and bone regeneration.

SpeciesApplicationTitle
mouse,humanWB

Bioact Mater

Engineering fibroblast with reprogramming and spheronization for bone defect repair

Authors - Yanjiao Li

Reviews

    1.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer tested this antibody on mouse embryonic brain sections (E13.5) by immunofluorescence at dilutions of 1:250, 1:500, and 1:1000. The antibody did not produce a working signal at any dilution tested. The reviewer noted it was not evaluated on adult mouse brain, as their application required embryonic tissue only. Overall, the single review reflects a negative experience with this product for its intended use case.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Jessica (Verified Customer) (03-19-2026)

This antibody was tried on mouse embryonic brain at E13.5 and did not work. Multiple dilutions were tried and none of them worked. It was not tested on adult mouse brain, but we only needed it for embryonic.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:250, 1:500, 1:1000
  • Cell Tissue Type: Mouse brain sections
Loading...
||
New chat

Able™

正在加载,请稍候...