DMC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DMC1 Polyclonal antibody (13714-1-AP)

DMC1 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 13714-1-AP Copied!

Publications (20)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

DMC1H, HsLim15, LIM15

• 

  WB analysis using 13714-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13714-1-AP (DMC1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 13714-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 13714-1-AP (DMC1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse testis using 13714-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using DMC1 antibody (13714-1-AP) at dilution of 1:1200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse testis using 13714-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using DMC1 antibody (13714-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse testis using 13714-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using DMC1 antibody (13714-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DMC1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, human testis tissue, rat testis tissue
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)-P: IF-P : 1:600-1:2400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13714-1-AP targets DMC1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4653

  Product name: Recombinant human DMC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC035658

  Sequence: MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTL

• Full Name: DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)
• Calculated Molecular Weight: 165 aa, 18 kDa, 38 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC035658
• Gene Symbol: DMC1
• Gene ID (NCBI): 11144
• RRID: AB_2091076
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14565
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The DMC1 Polyclonal antibody (Cat# 13714-1-AP) has 20 citations spanning 16 journals, including Nature Cell Biology, Nucleic Acids Research, Advanced Science, Cell Death & Differentiation, Cell Reports, Cell Proliferation, JCI Insight, Genome Research, Communications Biology, FASEB Journal, Frontiers in Oncology, Ecotoxicology and Environmental Safety, Food and Chemical Toxicology, Biochemical and Biophysical Research Communications, eLife, and bioRxiv. Research fields center on meiotic recombination, spermatogenesis, oocyte development, and reproductive biology, with additional applications in oncology and environmental toxicology.

Automatically generated from the 20 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Cell Biol; Single-cell multi-omics sequencing of human spermatogenesis reveals a DNA demethylation event associated with male meiotic recombination; Authors - Yaping Huang
mouse	IF	Nucleic Acids Res; MEIOK21: a new component of meiotic recombination bridges required for spermatogenesis.; Authors - Yongliang Shang
mouse	IF	Nucleic Acids Res; NAT10-mediated N4-acetylcytidine modification is required for meiosis entry and progression in male germ cells.; Authors - Lu Chen
mouse	IF	Adv Sci (Weinh); Ex Vivo Spatiotemporal Characterization of Spermatogenesis in Mouse Testicular Organoids.; Authors - Jiachen Sun
mouse	IF	Adv Sci (Weinh); m6A Reader hnRNPA2B1 Modulates Late Pachytene Progression in Male Meiosis Through Post-Transcriptional Control; Authors - Lisha Yin
mouse	IF	Cell Death Differ; NBS1 is required for SPO11-linked DNA double-strand break repair in male meiosis.; Authors - Bin Zhang