DMRTA1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DMRTA1 Polyclonal antibody, PBS Only (24356-1-PBS)

• 

  WB analysis of mouse liver using 24356-1-AP (same clone as 24356-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24356-1-AP (DMRTA1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24356-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 24356-1-AP (same clone as 24356-1-PBS)

  IP result of anti-DMRTA1 (IP:24356-1-AP, 3ug; Detection:24356-1-AP 1:500) with mouse liver tissue lysate 3000ug. This data was developed using the same antibody clone with 24356-1-PBS in a different storage buffer formulation.

DMRTA1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 24356-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

Doublesex- and mab-3-related transcription factor A1, DMO

---

Product Information

24356-1-PBS targets DMRTA1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18796

  Product name: Recombinant human DMRTA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 178-336 aa of BC130437

  Sequence: RAENPQSTGGPAAGAALGLGALRQASGSATPAFEVFQQDYPEEKQEQKESKCESCQNGQEELISKSHQLYLGSSSRSNGVIGKQSIGSSISEYSNKPDSILSPHPGEQSGGEESPRSLSSSDLESGNESEWVKDLTATKASLPTVSSRPRDPLDILTKI

• Full Name: DMRT-like family A1
• Calculated Molecular Weight: 504 aa, 53 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC130437
• Gene Symbol: DMRTA1
• Gene ID (NCBI): 63951
• RRID: AB_2879506
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VZB9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.