DMRTC2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DMRTC2 Polyclonal antibody, PBS Only (28101-1-PBS)

• 

  WB analysis using 28101-1-AP (same clone as 28101-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28101-1-AP (DMRTC2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28101-1-PBS in a different storage buffer formulation.

DMRTC2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28101-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Doublesex- and mab-3-related transcription factor C2

---

Product Information

28101-1-PBS targets DMRTC2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27355

  Product name: Recombinant human DMRTC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-129 aa of BC039266

  Sequence: MEPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQPQVPSGKENI

• Full Name: DMRT-like family C2
• Calculated Molecular Weight: 367 aa, 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC039266
• Gene Symbol: DMRTC2
• Gene ID (NCBI): 63946
• RRID: AB_3742277
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IXT2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Double sex and mab-3-related transcription factors (DMRT) like family C2 (DMRTC2), a member of the DMRT family genes, is involved in the regulation of mammalian sex differentiation and the process of spermatogenesis, particularly meiosis (PMID: 32244802). DMRTC2 is expressed in the testis and pancreas. DMRTC2 has 2 isoforms with the molecular mass of 24 and 39 kDa.