Use Able AI chat for product recommendations

DNAAF2 Polyclonal antibody, PBS Only

DNAAF2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 23228-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, Indirect ELISA

C14orf104, CILD10, Dynein assembly factor 2, axonemal, Dynein Axonemal Assembly Factor 2, KTU

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

23228-1-PBS targets DNAAF2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19741

Product name: Recombinant human C14orf104 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 606-837 aa of BC013322

Sequence: LRFSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLELQECSNSDQLQGKEERVNEESHLTEKEYIEHCNTPTTDSDSSIAVKALQIDSFGLVTCFQQESLDVSQMILGKSQQPESKMQSEFIKEKSATCSNEEKDNLNESVITEEKETDGDHLSSLLNKTTVHNIPGFDSIKETNMQDGSVQVIKDHVTNCAFSFQNSLLYDLD

Predict reactive species
Full Name chromosome 14 open reading frame 104
Calculated Molecular Weight 837 aa, 91 kDa
Observed Molecular Weight100-110 kDa
GenBank Accession NumberBC013322
Gene Symbol C14orf104
Gene ID (NCBI) 55172
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ9NVR5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DNAAF2 (Dynein Axonemal Assembly Factor 2) is a cytoplasmic protein involved in the assembly and maturation of outer dynein arms (ODAs) in ciliary and flagellar axonemes. DNAAF2 cooperates with DNAAF1, DNAAF3, and other factors to mediate the transport of dynein precursors from the cytoplasm to the ciliary base, and promotes the proper folding and localization of dynein complexes at the axonemal assembly site. Mutations in the DNAAF2 gene cause primary ciliary dyskinesia (PCD), characterized by chronic respiratory tract infections, situs inversus, and male infertility, due to defective mucociliary clearance resulting from impaired ciliary motility.

Loading...
||
New chat

Able

正在加载,请稍候...