DNAAF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DNAAF2 Polyclonal antibody, PBS Only (23228-1-PBS)

• 

  WB analysis using 23228-1-AP (same clone as 23228-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23228-1-AP (C14orf104 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23228-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat testis using 23228-1-AP (same clone as 23228-1-PBS)

  IP result of anti-C14orf104 (IP:23228-1-AP, 4ug; Detection:23228-1-AP 1:3000) with rat testis tissue lysate 1800 ug. This data was developed using the same antibody clone with 23228-1-PBS in a different storage buffer formulation.

DNAAF2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 23228-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

C14orf104, CILD10, Dynein assembly factor 2, axonemal, Dynein Axonemal Assembly Factor 2, KTU

---

Product Information

23228-1-PBS targets DNAAF2 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19741

  Product name: Recombinant human C14orf104 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 606-837 aa of BC013322

  Sequence: LRFSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLELQECSNSDQLQGKEERVNEESHLTEKEYIEHCNTPTTDSDSSIAVKALQIDSFGLVTCFQQESLDVSQMILGKSQQPESKMQSEFIKEKSATCSNEEKDNLNESVITEEKETDGDHLSSLLNKTTVHNIPGFDSIKETNMQDGSVQVIKDHVTNCAFSFQNSLLYDLD

• Full Name: chromosome 14 open reading frame 104
• Calculated Molecular Weight: 837 aa, 91 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC013322
• Gene Symbol: C14orf104
• Gene ID (NCBI): 55172
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9NVR5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DNAAF2 (Dynein Axonemal Assembly Factor 2) is a cytoplasmic protein involved in the assembly and maturation of outer dynein arms (ODAs) in ciliary and flagellar axonemes. DNAAF2 cooperates with DNAAF1, DNAAF3, and other factors to mediate the transport of dynein precursors from the cytoplasm to the ciliary base, and promotes the proper folding and localization of dynein complexes at the axonemal assembly site. Mutations in the DNAAF2 gene cause primary ciliary dyskinesia (PCD), characterized by chronic respiratory tract infections, situs inversus, and male infertility, due to defective mucociliary clearance resulting from impaired ciliary motility.