DNAH17 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DNAH17 Polyclonal antibody (24488-1-AP)

DNAH17 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24488-1-AP Copied!

Publications (15)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

DNAHL1, DNEL2

• 

  WB analysis using 24488-1-AP

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 24488-1-AP (DNAH17 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 24488-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24488-1-AP (DNAH17 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 24488-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24488-1-AP (DNAH17 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DNAH17 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24488-1-AP targets DNAH17 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20033

  Product name: Recombinant human DNAH17 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 299-644 aa of BC112284

  Sequence: MEQADFTMLPTFIAKVLDTICFIWATSEYYNTPARIIVILQEFCNQIIEMTRTFLSPEEVLKGLQGEIEEVLSGISLAVNVLKELYQTYDFCCVNMKLFFKDKEPVPWEFPSSLAFSRINSFFQRIQTIEELYKTAIEFLKLEKIELGGVRGNLLGSLVTRIYDEVFELVKVFADCKYDPLDPGDSNFDRDYADFEIKIQDLDRRLATIFCQGFDDCSCIKSSAKLLYMCGGLMERPLILAEVAPRYSVMLELFDAELDNAKILYDAQMAASEEGNIPLIHKNMPPVAGQLKWSLELQERLEVSMKHLKHVEHPVMSGAEAKLTYQKYDEMMELLRCHREKIYQQW

• Full Name: dynein, axonemal, heavy chain 17
• Calculated Molecular Weight: 4485 aa, 512 kDa
• Observed Molecular Weight: 500-512 kDa
• GenBank Accession Number: BC112284
• Gene Symbol: DNAH17
• Gene ID (NCBI): 8632
• RRID: AB_2879568
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UFH2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The DNAH17 Polyclonal antibody (Cat# 24488-1-AP) has 15 total citations spanning journals including Cell, Nature Communications, Human Molecular Genetics, Human Genetics, Andrology, Asian Journal of Andrology, Clinical Genetics, and eLife. The research fields are predominantly male infertility, sperm flagellar ultrastructure, multiple morphological abnormalities of the flagella (MAF), asthenozoospermia, and primary ciliary dyskinesia, with applications in IF, WB, and CoIP.

Automatically generated from the 15 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell; Structures of sperm flagellar doublet microtubules expand the genetic spectrum of male infertility; Authors - Lunni Zhou
mouse	IF	Nat Commun; Doublet microtubule-associated tektins and enzymes differentially regulate sperm flagellar integrity and motility.; Authors - Qi Liu
human	WB	Ecotoxicol Environ Saf; Microcystin leucine arginine induces human sperm damage: Involvement of the Ca2+/CaMKKβ/AMPK pathway; Authors - Xing Guo
mouse,human	IF	Reprod Biomed Online; A novel mutation in DNAH17 is present in a patient with multiple morphological abnormalities of the flagella.; Authors - Rui Zheng
human	IF	Hum Genet; Biallelic loss-of-function variants of DNAH7 cause male infertility associated with asthenozoospermia in humans.; Authors - Guicheng Zhao
human	WB,IF	Andrology; A novel homozygous LRRC6 mutation causes male infertility with asthenozoospermia and primary ciliary dyskinesia in humans; Authors - Shengjia Shi