DNAH17 Polyclonal antibody

• 

  WB analysis using 24488-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24488-1-AP (DNAH17 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 24488-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24488-1-AP (DNAH17 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 24488-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24488-1-AP (DNAH17 Antibody) at dilution of 1:50 (under 40x lens).

DNAH17 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24488-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

DNAH17, DNAHL1, DNEL2

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 8 publications below

Product Information

24488-1-AP targets DNAH17 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20033

  Product name: Recombinant human DNAH17 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 299-644 aa of BC112284

  Sequence: MEQADFTMLPTFIAKVLDTICFIWATSEYYNTPARIIVILQEFCNQIIEMTRTFLSPEEVLKGLQGEIEEVLSGISLAVNVLKELYQTYDFCCVNMKLFFKDKEPVPWEFPSSLAFSRINSFFQRIQTIEELYKTAIEFLKLEKIELGGVRGNLLGSLVTRIYDEVFELVKVFADCKYDPLDPGDSNFDRDYADFEIKIQDLDRRLATIFCQGFDDCSCIKSSAKLLYMCGGLMERPLILAEVAPRYSVMLELFDAELDNAKILYDAQMAASEEGNIPLIHKNMPPVAGQLKWSLELQERLEVSMKHLKHVEHPVMSGAEAKLTYQKYDEMMELLRCHREKIYQQW

• Full Name: dynein, axonemal, heavy chain 17
• Calculated Molecular Weight: 4485 aa, 512 kDa
• Observed Molecular Weight: 500-512 kDa
• GenBank Accession Number: BC112284
• Gene Symbol: DNAH17
• Gene ID (NCBI): 8632
• RRID: AB_2879568
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UFH2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Elife; DNAH3 deficiency causes flagellar inner dynein arm loss and male infertility in humans and mice; Authors - Xiang Wang
human	IF	Clin Genet; Loss-of-function mutation in DNAH8 induces asthenoteratospermia associated with multiple morphological abnormalities of the sperm flagella.; Authors - Yihong Yang
human,mouse	IF	Reprod Biomed Online; A novel mutation in DNAH17 is present in a patient with multiple morphological abnormalities of the flagella.; Authors - Rui Zheng
human, mouse	IF	J Assist Reprod Genet; The effect of a novel LRRC6 mutation on the flagellar ultrastructure in a primary ciliary dyskinesia patient.; Authors - Yaqian Li
human	WB,IF	Ann Hum Genet; DNAH17 is associated with asthenozoospermia and multiple morphological abnormalities of sperm flagella.; Authors - Yanwei Sha
human	IF	Hum Mol Genet; Population-based genetic analysis in infertile men reveals novel mutations of ADAD family members in patients with impaired spermatogenesis; Authors - Siyu Dai