DNAJA2 Polyclonal antibody

• 

  WB analysis of A375 using 12236-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 12236-1-AP (DNAJA2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 12236-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12236-1-AP (DNAJA2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 12236-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 12236-1-AP (DNAJA2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A375 using 12236-1-AP

  IP result of anti-DNAJA2 (IP:12236-1-AP, 4ug; Detection:12236-1-AP 1:300) with A375 cells lysate 3600 ug.

• 

  IF Staining of MCF-7 using 12236-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using 12236-1-AP (DNAJA2 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated Goat Anti-Rabbit IgG(H+L).

DNAJA2 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 12236-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, CoIP, ELISA

Synonyms

HIRA interacting protein 4, Dnj3, DNAJ, DJA2, Dj3

---

Tested Applications

• Positive WB detected in: A375 cells, mouse kidney tissue, human brain tissue
• Positive IP detected in: A375 cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 9 publications below
• IF: See 2 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below

Product Information

12236-1-AP targets DNAJA2 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2877

  Product name: Recombinant human DNAJA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-214 aa of BC015809

  Sequence: MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEV

• Full Name: DnaJ (Hsp40) homolog, subfamily A, member 2
• Calculated Molecular Weight: 417 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC015809
• Gene Symbol: DNAJA2
• Gene ID (NCBI): 10294
• RRID: AB_2230709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60884
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Metamorphism in TDP-43 prion-like domain determines chaperone recognition; Authors - Jaime Carrasco
human	WB	Int J Cancer; Down-regulation of BiP/GRP78 sensitizes resistant prostate cancer cells to gene-therapeutic overexpression of REIC/Dkk-3.; Authors - Tanimoto Ryuta R
human	WB	Mol Biol Cell; Mechanism of chaperone recruitment and retention on mitochondrial precursors; Authors - Szymon Juszkiewicz
human	WB	J Biol Chem; A cytosolic chaperone complex controls folding and degradation of type III CD38.; Authors - Yang Wu
human	WB	Cancers (Basel); Mutant p53 Depletion by Novel Inhibitors for HSP40/J-Domain Proteins Derived from the Natural Compound Plumbagin; Authors - Mohamed Alalem
human,mouse	WB,IP	J Biol Chem; Quantitative interactome proteomics identifies a proteostasis network for GABAA receptors; Authors - Ya-Juan Wang