DNAJB1 Monoclonal antibody

• 

  WB analysis using 67422-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67422-1-Ig (DNAJB1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 67422-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DNAJB1 antibody (67422-1-Ig, Clone: 1E8E10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red).

• 

  FC experiment of HeLa using 67422-1-Ig

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human DNAJB1 (67422-1-Ig, Clone:1E8E10) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

DNAJB1 Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 67422-1-Ig

Clone No.1E8E10

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

1E8E10, DnaJ protein homolog 1, DNAJ1, hDj 1, Hdj1

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67422-1-Ig targets DNAJB1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3830

  Product name: Recombinant human DNAJB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-340 aa of BC019827

  Sequence: MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

• Full Name: DnaJ (Hsp40) homolog, subfamily B, member 1
• Calculated Molecular Weight: 340 aa, 40 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC019827
• Gene Symbol: DNAJB1
• Gene ID (NCBI): 3337
• RRID: AB_2882662
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P25685
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNAJB1 is a member of the heat shock 40 protein family and has been involved in a variety of cellular processes, including the proteasome pathway, endoplasmic reticulum stress and viral infection. DNAJB1-PRKACA gene fusions have been considered diagnostic for fibrolamellar hepatocellular carcinoma.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell Biol; An Important Role for RPRD1B in the Heat Shock Response; Authors - Simona Cugusi