DNAJC11 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DNAJC11 Polyclonal antibody (17331-1-AP)

DNAJC11 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17331-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

DNAJC11

• 

  WB analysis of HeLa using 17331-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17331-1-AP (DNAJC11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 17331-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17331-1-AP (DNAJC11 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 17331-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17331-1-AP (DNAJC11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 17331-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 17331-1-AP (DNAJC11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 17331-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 17331-1-AP (DNAJC11 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 17331-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17331-1-AP (DNAJC11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 17331-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17331-1-AP (DNAJC11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 17331-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17331-1-AP (DNAJC11 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 17331-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17331-1-AP (DNAJC11 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DNAJC11 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, SH-SY5Y cells, HepG2 cells, mouse liver tissue
• Positive IHC detected in: human liver tissue, human skeletal muscle tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17331-1-AP targets DNAJC11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11310

  Product name: Recombinant human DNAJC11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 162-507 aa of BC014145

  Sequence: MHISQSIEAPLTATDTAILSGSLSTQNGNGGGSINFALRRVTSAKGWGELEFGAGDLQGPLFGLKLFRNLTPRCFVTTNCALQFSSRGIRPGLTTVLARNLDKNTVGYLQWRWGIQSAMNTSIVRDTKTSHFTVALQLGIPHSFALISYQHKFQDDDQTRVKGSLKAGFFGTVVEYGAERKISRHSVLGAAVSVGVPQGVSLKVKELEKQRESAATDVLQKKQEAESAVRLMQESVRRIIEAEESRMGLIIVNAWYGKFVNDKSRKSEKVKVIDVTVPLQCLVKDSKLILTEASKAGLPGFYDPCVGEEKNLKVLYQFRGVLHQVMVLDSEALRIPKQSHRIDTDG

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 11
• Calculated Molecular Weight: 507 aa, 57 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC014145
• Gene Symbol: DNAJC11
• Gene ID (NCBI): 55735
• RRID: AB_2878385
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVH1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNAJC11 is a member of the J proteins also known as HSP40 family of co-chaperones. Recently DNAJC11 has been found to interact with mitofilin, a mitochondrial inner membrane protein, indicating that it may be a molecular chaperone during mitochondrial protein import and folding.

Publications

What published studies show

The DNAJC11 Polyclonal antibody (Cat# 17331-1-AP) has 6 citations across journals including Nature Cell Biology, Science Advances, Journal of Proteome Research, PLoS One, and bioRxiv. Research fields span mitochondrial biology, molecular chaperone function, protein interactome mapping, neuromuscular pathology, and structural evolution of mitochondrial insertases (MTCH family). All cited applications are Western blot, with species covering human and mouse.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Nat Cell Biol; Small heat shock proteins operate as molecular chaperones in the mitochondrial intermembrane space; Authors - Elias Adriaenssens
human	WB	Sci Adv; Structural evolution of the MTCH family of mitochondrial insertases.; Authors - Taylor A. Stevens
	WB	Sci Adv; ARMC1 partitions between distinct complexes and assembles MIRO with MTFR to control mitochondrial distribution; Authors - Michael J McKenna
human	WB	J Proteome Res; Mapping Interactome Networks of DNAJC11, a Novel Mitochondrial Protein Causing Neuromuscular Pathology in Mice.; Authors - Foteini Violitzi
mouse	WB	PLoS One; A Splicing Mutation in the Novel Mitochondrial Protein DNAJC11 Causes Motor Neuron Pathology Associated with Cristae Disorganization, and Lymphoid Abnormalities in Mice.; Authors - Fotis Ioakeimidis
human	WB	bioRxiv; Structural evolution of the MTCH family of mitochondrial insertases.; Authors - Taylor A. Stevens ; KD Validated