DNAJC16 Polyclonal antibody

• 

  WB analysis of mouse brain using 17599-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17599-1-AP (DNAJC16 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 17599-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17599-1-AP (DNAJC16 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

DNAJC16 Polyclonal Antibody for WB, ELISA

Cat No. 17599-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

DNAJC16, KIAA0962

---

Tested Applications

• Positive WB detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IF: See 1 publications below

Product Information

17599-1-AP targets DNAJC16 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11637

  Product name: Recombinant human DNAJC16 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 69-399 aa of BC047363

  Sequence: KFIQISKAYEILSNEEKRSNYDQYGDAGENQGYQKQQQQREYRFRHFHENFYFDESFFHFPFNSERRDSIDEKYLLHFSHYVNEVVPDSFKKPYLIKITSDWCFSCIHIEPVWKEVIQELEELGVGIGVVHAGYERRLAHHLGAHSTPSILGIINGKISFFHNAVVRENLRQFVESLLPGNLVEKVTNKNYVRFLSGWQQENKPHVLLFDQTPIVPLLYKLTAFAYKDYLSFGYVYVGLRGTEEMTRRYNINIYAPTLLVFKEHINRPADVIQARGMKKQIIDDFITRNKYLLAARLTSQKLFHELCPVKRSHRQRKYCVVLLTAETTKLS

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 16
• Calculated Molecular Weight: 782 aa, 91 kDa
• Observed Molecular Weight: 91 kDa
• GenBank Accession Number: BC047363
• Gene Symbol: DNAJC16
• Gene ID (NCBI): 23341
• RRID: AB_2277530
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2G8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	J Cell Biol; ERdj8 governs the size of autophagosomes during the formation process.; Authors - Yo-Hei Yamamoto
human	WB	J Cell Biol; Correction: ERdj8 governs the size of autophagosomes during the formation process.; Authors - Yo-Hei Yamamoto ; KD Validated