DNAJC16 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DNAJC16 Polyclonal antibody (17599-1-AP)

• Featured Product
• KD/KO Validated

DNAJC16 Polyclonal Antibody for WB, ELISA

Cat No. 17599-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

DNAJC16, KIAA0962

• 

  WB analysis of mouse brain using 17599-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17599-1-AP (DNAJC16 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 17599-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17599-1-AP (DNAJC16 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DNAJC16 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17599-1-AP targets DNAJC16 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11637

  Product name: Recombinant human DNAJC16 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 69-399 aa of BC047363

  Sequence: KFIQISKAYEILSNEEKRSNYDQYGDAGENQGYQKQQQQREYRFRHFHENFYFDESFFHFPFNSERRDSIDEKYLLHFSHYVNEVVPDSFKKPYLIKITSDWCFSCIHIEPVWKEVIQELEELGVGIGVVHAGYERRLAHHLGAHSTPSILGIINGKISFFHNAVVRENLRQFVESLLPGNLVEKVTNKNYVRFLSGWQQENKPHVLLFDQTPIVPLLYKLTAFAYKDYLSFGYVYVGLRGTEEMTRRYNINIYAPTLLVFKEHINRPADVIQARGMKKQIIDDFITRNKYLLAARLTSQKLFHELCPVKRSHRQRKYCVVLLTAETTKLS

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 16
• Calculated Molecular Weight: 782 aa, 91 kDa
• Observed Molecular Weight: 91 kDa
• GenBank Accession Number: BC047363
• Gene Symbol: DNAJC16
• Gene ID (NCBI): 23341
• RRID: AB_2277530
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2G8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The DNAJC16 Polyclonal antibody (Cat# 17599-1-AP) has a total of 2 citations, both published in Journal of Cell Biology (IF 6.1). Both citations relate to research on ERdj8/DNAJC16's role in governing autophagosome size during autophagosome formation, placing them in the fields of cell biology and autophagy. The antibody was applied in WB and IF in these studies using human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	J Cell Biol; ERdj8 governs the size of autophagosomes during the formation process.; Authors - Yo-Hei Yamamoto
human	WB	J Cell Biol; Correction: ERdj8 governs the size of autophagosomes during the formation process.; Authors - Yo-Hei Yamamoto ; KD Validated