DNAJC5B Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86975-4-RR (same clone as 86975-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86975-4-RR (DNAJC5B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86975-4-PBS in a different storage buffer formulation.

DNAJC5B Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86975-4-PBS

Clone No.252079D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Beta CSP, Beta cysteine string protein, CSP beta, CSP-beta, Cysteine-string protein isoform beta

---

Product Information

86975-4-PBS targets DNAJC5B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10744

  Product name: Recombinant human DNAJC5B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-199 aa of BC016742

  Sequence: MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 5 beta
• Calculated Molecular Weight: 199 aa, 22 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC016742
• Gene Symbol: DNAJC5B
• Gene ID (NCBI): 85479
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UF47
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DNAJC5B encodes cysteine string proteins (CSP) beta. CSPs belong to the DnaJ-like chaperone family and play an important role in regulated exocytosis in neurons and endocrine cells. Mammals express three CSP proteins, α, β, γ. In contrast to the CSPα which is ubiquitously expressed, CSPβ is restricted to testis and auditory hair cell neurons. The predicted MW of DNAJC5B is around 22 kDa, while some modified forms exist (PMID: 17034881)