DNAJC5G Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DNAJC5G Polyclonal antibody, PBS Only (27373-1-PBS)

• 

  WB analysis using 27373-1-AP (same clone as 27373-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27373-1-AP (DNAJC5G antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27373-1-PBS in a different storage buffer formulation.

DNAJC5G Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27373-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CSP gamma, Gamma CSP, Gamma cysteine string protein

---

Product Information

27373-1-PBS targets DNAJC5G in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11748

  Product name: Recombinant human DNAJC5G protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-189 aa of BC035194

  Sequence: MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRYHPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILNSCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFRSEENSEDDF

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 5 gamma
• Calculated Molecular Weight: 189 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC035194
• Gene Symbol: DNAJC5G
• Gene ID (NCBI): 285126
• RRID: AB_3742229
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N7S2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.