DNAJC6/AUXILIN Polyclonal antibody

• 

  WB analysis of HeLa using 21941-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21941-1-AP (DNAJC6/AUXILIN antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21941-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21941-1-AP (DNAJC6/AUXILIN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 21941-1-AP

  IP result of anti-DNAJC6/AUXILIN (IP:21941-1-AP, 4ug; Detection:21941-1-AP 1:2000) with mouse brain tissue lysate 4000 ug.

• 

  IHC staining of mouse brain using 21941-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21941-1-AP (DNAJC6/AUXILIN antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 21941-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21941-1-AP (DNAJC6/AUXILIN antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 21941-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using DNAJC6/AUXILIN antibody (21941-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

DNAJC6/AUXILIN Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21941-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Auxilin, DNAJC6, DJC6, EC:3.1.3.-, KIAA0473

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HeLa cells, mouse cerebellum tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

21941-1-AP targets DNAJC6/AUXILIN in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16612

  Product name: Recombinant human DNAJC6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 387-733 aa of BC109279

  Sequence: IPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDVELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLALGGQAPIDIPPDNPRHYGQSGFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFLNTSSASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHAKPGGFGMGSKSAATSPTGSSHGTPTHQSKPQTL

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 6
• Calculated Molecular Weight: 970 aa, 106 kDa
• Observed Molecular Weight: 100-110 kDa, 86 kDa
• GenBank Accession Number: BC109279
• Gene Symbol: DNAJC6/AUXILIN
• Gene ID (NCBI): 9829
• RRID: AB_2878951
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75061
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNAJC6, also named AUXILIN, belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. It is a neuronal protein that functions specifically in the pathway of clathrin-mediated endocytosis. It shares homology with GAK, and the two proteins act as cochaperones to support the HSC70 -dependent clathrin uncoating of clathrin-coated vesicles (PMID: 2016009). DNAJC6 is expressed in various brain regions, including cerebellum, corpus callosum, cortex, striatum, brainstem, pons, putamen, spinal cord and substantia nigra (PMID: 23211418).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse		Sci Rep; Differential regulation of synaptic AP-2/clathrin vesicle uncoating in synaptic plasticity.; Authors - Ermes Candiello
human	WB	Cancers (Basel); Mutant p53 Depletion by Novel Inhibitors for HSP40/J-Domain Proteins Derived from the Natural Compound Plumbagin; Authors - Mohamed Alalem
mouse,human	WB,IHC	Sci Rep; Genes related to neural tube defects and glioblastoma; Authors - Rui Cao