• Featured Product
  • KD/KO Validated

DNAJC9 Polyclonal antibody

DNAJC9 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 25444-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

SB73, KIAA0974, JDD1, HDJC9, DnaJ protein SB73

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, SH-SY5Y cells, Raji cells, HeLa cells
Positive IHC detected inhuman breast cancer tissue, human colon cancer tissue, mouse colon tissue, rat colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 4 publications below

Product Information

25444-1-AP targets DNAJC9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22123

Product name: Recombinant human DNAJC9 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-260 aa of BC136507

Sequence: MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK

Predict reactive species
Full Name DnaJ (Hsp40) homolog, subfamily C, member 9
Calculated Molecular Weight 260 aa, 30 kDa
Observed Molecular Weight 30-35 kDa
GenBank Accession NumberBC136507
Gene Symbol DNAJC9
Gene ID (NCBI) 23234
RRIDAB_2880084
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WXX5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNAJC9, DnaJ homolog subfamily C member 9, acts as a dual histone chaperone and heat shock co-chaperone (PMID: 33857403). As a histone chaperone, DNAJC9 forms a co-chaperone complex with MCM2 and histone H3-H4 heterodimers (PMID: 33857403). DNAJC9 also plays a role as co-chaperone of the HSP70 family of molecular chaperone proteins. (PMID: 17182002, PMID: 33857403). DNAJC9 exhibits activity to assemble histones onto DNA (PMID: 33857403). DNAJC9 is an essential protein in many cancer cell types and the levels of the protein correlate with the rates at which cancer cells proliferate.

Protocols

Product Specific Protocols
WB protocol for DNAJC9 antibody 25444-1-APDownload protocol
IF protocol for DNAJC9 antibody 25444-1-APDownload protocol
IHC protocol for DNAJC9 antibody 25444-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Sci Rep

Label-free Quantitative Analysis of Protein Expression Alterations in miR-26a-Knockout HeLa Cells using SWATH-MS Technology.

Authors - Hexiao Shen
humanWB

bioRxiv

Mechanism of ASF1 Inhibition by CDAN1

Authors - Samantha F Sedor
humanWB

Nat Commun

Mechanism of ASF1 engagement by CDAN1

Authors - Samantha F Sedor
humanWB

J Med Virol

DNAJC9 Binds to and Enhances the Transcription of Hepatitis B Virus cccDNA by Recruiting Histone H3.3

Authors - Tianhao Mao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

HELENA (Verified Customer) (04-26-2023)

Samples correspond to activated human primary CD4+ T cells after knock-out of DNAJC9 by CRISPR/CAS9.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human primary CD4+ T cells
DNAJC9 Antibody Western Blot validation (1:1000 dilution) in Human primary CD4+ T cells (Cat no:25444-1-AP)
FH

Sven (Verified Customer) (11-27-2021)

Works very well on western blot for human and mouse tissue (1:5000 dilution in TBS-T with 50% glycerol, 2% BSA, 0.02% NaN3). Antiboydy specificity was validated by DNAJC9 knockout cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Human + Mouse pancreatic cancer cell lines
DNAJC9 Antibody Western Blot validation (1:5000 dilution) in Human + Mouse pancreatic cancer cell lines (Cat no:25444-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...