DNAL4 Polyclonal antibody

• 

  WB analysis of mouse testis using 10388-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 10388-1-AP (DNAL4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10388-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10388-1-AP (DNAL4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

DNAL4 Polyclonal Antibody for WB, ELISA

Cat No. 10388-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA, IF

Synonyms

DNAL4, Dynein light chain 4, axonemal, PIG27

---

Tested Applications

• Positive WB detected in: mouse testis tissue, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

10388-1-AP targets DNAL4 in WB, ELISA, IF applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0587

  Product name: Recombinant human DNAL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-105 aa of BC002968

  Sequence: MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS

• Full Name: dynein, axonemal, light chain 4
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC002968
• Gene Symbol: DNAL4
• Gene ID (NCBI): 10126
• RRID: AB_2230810
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O96015
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Andrology; A novel homozygous LRRC6 mutation causes male infertility with asthenozoospermia and primary ciliary dyskinesia in humans; Authors - Shengjia Shi