DNASE1L2 Polyclonal antibody

• 

DNASE1L2 Polyclonal Antibody for ELISA

Cat No. 17386-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

Deoxyribonuclease 1 like 2, deoxyribonuclease I like 2, DHP1, DNAS1L2, DNase I homolog protein DHP1, DNase I like 2, DNASE1L2

---

Product Information

17386-1-AP targets DNASE1L2 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11270

  Product name: Recombinant human DNASE1L2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-299 aa of BC035205

  Sequence: MGGPRALLAALWALEAAGTAALRIGAFNIQSFGDSKVSDPACGSIIAKILAGYDLALVQEVRDPDLSAVSALMEQINSVSEHEYSFVSSQPLGRDQYKEMYLFVYRKDAVSVVDTYLYPDPEDVFSREPFVVKFSAPGTGERAPPLPSRRALTPPPLPAAAQNLVLIPLHAAPHQAVAEIDALYDVYLDVIDKWGTDDMLFLGDFNADCSYVRAQDWAAIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVACGARLRRSLKPQSATVHDFQEEFGLDQTQALAISDHFPVEVTLKFHR

• Full Name: deoxyribonuclease I-like 2
• Calculated Molecular Weight: 299 aa, 33 kDa
• GenBank Accession Number: BC035205
• Gene Symbol: DNASE1L2
• Gene ID (NCBI): 1775
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92874
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.