DNLZ Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DNLZ Polyclonal antibody, PBS Only (31844-1-PBS)

• 

  WB analysis using 31844-1-AP (same clone as 31844-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31844-1-AP (DNLZ antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31844-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 31844-1-AP (same clone as 31844-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 31844-1-AP (DNLZ antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31844-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 31844-1-AP (same clone as 31844-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 31844-1-AP (DNLZ antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31844-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 31844-1-AP (same clone as 31844-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 31844-1-AP (DNLZ antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31844-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 31844-1-AP (same clone as 31844-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 31844-1-AP (DNLZ antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31844-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 31844-1-AP (same clone as 31844-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using DNLZ antibody (31844-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31844-1-PBS in a different storage buffer formulation.

DNLZ Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31844-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

mtHsp70-escort protein, Hsp70-escort protein 1, HEP1, DNL-type zinc finger protein, C9orf151

---

Product Information

31844-1-PBS targets DNLZ in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37114

  Product name: Recombinant human DNLZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-178 aa of BC146915

  Sequence: MLRTALRGAPRLLSRVQPRAPCLRRLWGRGARPEVAGRRRAWAWGWRRSSSEQGPGPAAALGRVEAAHYQLVYTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGEDEGPPSPGKTEPS

• Full Name: DNL-type zinc finger
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC146915
• Gene Symbol: DNLZ
• Gene ID (NCBI): 728489
• RRID: AB_3670126
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5SXM8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DNL-type zinc finger (DNLZ, also known as HEP, ZIM17, TIMM15, and C9orf151) is a nuclear-encoded protein that is translocated to the mitochondria, thus it is located in mitochondrion and nucleoplasm (PMID: 22162012). It may function as a co-chaperone towards HSPA9/mortalin, which enhances HSPA9 solubility and stimulates HSPA9 catalytic activity (PMID: 18632665; 20392697; 21530495).