DNMBP Polyclonal antibody

• 

  WB analysis of mouse brain using 17191-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17191-1-AP (DNMBP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 17191-1-AP

  IP result of anti-DNMBP (IP:17191-1-AP, 4ug; Detection:17191-1-AP 1:1000) with mouse testis tissue lysate 10000ug.

• 

  IP experiment using 17191-1-AP

  IP result of DNMBP antibody (17191-1-AP for IP and Detection) with mouse testis tissue lysate.

DNMBP Polyclonal Antibody for WB, IP, ELISA

Cat No. 17191-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

DNMBP, dynamin binding protein, KIAA1010, Scaffold protein Tuba, TUBA

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IP detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

17191-1-AP targets DNMBP in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10973

  Product name: Recombinant human DNMBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 473-824 aa of BC041628

  Sequence: RVLQQLQVFTFFPESLPATKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASVGSHSSTESEHGSSSPRFPRQNSGSTLTFNPSSMAVSFTSGSCQKQPQDASPPPKEWDQGTLSASLNPSNSESSPSRCPSDPDSTSQPRSGDSADVARDVKQPTATPRSYRNFRHPEIVGYSVPGRNGQSQDLVKGCARTAQAPEDRSTEPDGSEAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT

• Full Name: dynamin binding protein
• Calculated Molecular Weight: 823aa,94 kDa; 1577aa,177 kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: BC041628
• Gene Symbol: DNMBP
• Gene ID (NCBI): 23268
• RRID: AB_2230665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6XZF7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Mouse	WB	Aging (Albany NY); The mechanism of simultaneous intake of Jujuboside A and B in the regulation of sleep at the hypothalamic level; Authors - Wei Wang