Tested Applications
| Positive WB detected in | HeLa cells, C6 cells, HEK-293 cells, HepG2 cells, Jurkat cells |
| Positive IP detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24206-1-AP targets DNMT1 in WB, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, zebrafish, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19116 Product name: Recombinant human DNMT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1288-1632 aa of BC126227 Sequence: VSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD Predict reactive species |
| Full Name | DNA (cytosine-5-)-methyltransferase 1 |
| Calculated Molecular Weight | 1632 aa, 185 kDa |
| Observed Molecular Weight | 180-200 kDa |
| GenBank Accession Number | BC126227 |
| Gene Symbol | DNMT1 |
| Gene ID (NCBI) | 1786 |
| RRID | AB_2879457 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P26358 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DNA methylation is a major epigenetic modification that regulates gene expression. DNMT1, the maintenance DNA methylation enzyme, is the primary enzyme responsible for copying methylation patterns after DNA replication. DNMT1 is required for X chromosome inactivation, imprinting, genomic methylation and proper embryonic development. Overexpression of DNMT1 has been reported in various cancers. DNMT1 exists some isoforms with MW 184 kDa and 145 kDa. (PMID: 10753866)
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for DNMT1 antibody 24206-1-AP | Download protocol |
| WB protocol for DNMT1 antibody 24206-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-DNMT1 antibody (Cat# 24206-1-AP) has accumulated 132 citations across high-impact journals including Nature Cancer, Molecular Cancer, Advanced Science, Cell Reports Medicine, Science Advances, and EMBO Journal. Associated research fields span epigenetics and DNA methylation, oncology (hepatocellular, colorectal, lung, breast, and prostate cancers), ferroptosis, cardiology, neurology, developmental biology, immunology, and animal science.
| Species | Application | Title |
|---|---|---|
Mol Cancer Crosstalk between 5-methylcytosine and N6-methyladenosine machinery defines disease progression, therapeutic response and pharmacogenomic landscape in hepatocellular carcinoma | ||
Bioact Mater Matrix stiffness exacerbates the proinflammatory responses of vascular smooth muscle cell through the DDR1-DNMT1 mechanotransduction axis.
| ||
J Adv Res UHRF1-mediated DNA 5-mC modification drives super-enhancer redistribution and impedes osteogenesis via TGM2-regulated autophagic flux in senile osteoporosis. | ||
Redox Biol DNMT1-DUOXA1 axis discovers a novel methylation-ferroptosis circuit in bicalutamide-resistant prostate cancer.
| ||
Theranostics Targeting CPS1 attenuates lung cancer metastasis by regulating EMT through an epigenetic mechanism. |
Reviews
What customers say
Both reviewers used this antibody for Western Blot. One reported excellent results on HeLa cells at 1/1000 dilution with a 1-hour room temperature incubation, noting a clean band at the expected molecular weight and giving it 5 stars. The other tested it on fetal rat lung tissue at 1:500 dilution and observed correct molecular weight bands but significant background smear, rating it 3 stars. Overall, the antibody performs well for detecting its target in human cell lines, though users working with tissue samples may experience more background and should consider optimizing dilution or blocking conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Roy (Verified Customer) (09-17-2025) | Great band at the expected size. The dilution used was 1/1000 with an 1h incubation at Room Temperature
 |
Paula (Verified Customer) (12-14-2021) | good bands at the right molecular weight, but a lot of smear
 |
