DOCK4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DOCK4 Polyclonal antibody (27151-1-AP)

DOCK4 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27151-1-AP Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA
For FC, select conjugated version.

Synonyms

dedicator of cytokinesis 4, KIAA0716

• 

  WB analysis of HEK-293T using 27151-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 27151-1-AP (DOCK4 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 27151-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 27151-1-AP (DOCK4 antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DOCK4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27151-1-AP targets DOCK4 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25946

  Product name: Recombinant human DOCK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1838-1971 aa of BC117689

  Sequence: RPTQTASPARHTTSVSPSPAGRSPLKGSVQSFTPSPVEYHSPGLISNSPVLSGSYSSGISSLSRCSTSETSGFENQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPIPLPHSLSIPVTS

• Full Name: dedicator of cytokinesis 4
• Calculated Molecular Weight: 2011 aa, 230 kDa
• Observed Molecular Weight: 225 kDa
• GenBank Accession Number: BC117689
• Gene Symbol: DOCK4
• Gene ID (NCBI): 9732
• RRID: AB_2880776
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N1I0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DOCK4, originally identified as a product of a gene which is deleted during tumor progression, is a member of DOCK180 family proteins. Dock4 has been found recently to be associated with several neuropsychiatric diseases, including autism, dyslexia, and schizophrenia. Multiple studies in fibroblasts then confirmed that Dock4 is capable of controlling cell migration by transducing several upstream signals, such as Wnt, platelet-derived growth factor, and RhoG, toward activation of Rac1. Mutations in this gene have been associated with ovarian, prostate, glioma, and colorectal cancers.