DOCK4 Polyclonal antibody

• 

  WB analysis of HEK-293T using 27151-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 27151-1-AP (DOCK4 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 27151-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 27151-1-AP (DOCK4 antibody) at dilution of 1:50 and CoraLite488-Conjugated Goat Anti-Rabbit IgG(H+L).

DOCK4 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27151-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

dedicator of cytokinesis 4, DOCK4, KIAA0716

---

Tested Applications

• Positive WB detected in: HEK-293T cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27151-1-AP targets DOCK4 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25946

  Product name: Recombinant human DOCK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1838-1971 aa of BC117689

  Sequence: RPTQTASPARHTTSVSPSPAGRSPLKGSVQSFTPSPVEYHSPGLISNSPVLSGSYSSGISSLSRCSTSETSGFENQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPIPLPHSLSIPVTS

• Full Name: dedicator of cytokinesis 4
• Calculated Molecular Weight: 2011 aa, 230 kDa
• Observed Molecular Weight: 225 kDa
• GenBank Accession Number: BC117689
• Gene Symbol: DOCK4
• Gene ID (NCBI): 9732
• RRID: AB_2880776
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N1I0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.