CoraLite® Plus 488-conjugated DOCK4 Polyclonal antibody

DOCK4 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-27151

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

dedicator of cytokinesis 4, KIAA0716

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27151 targets DOCK4 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25946

Product name: Recombinant human DOCK4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1838-1971 aa of BC117689

Sequence: RPTQTASPARHTTSVSPSPAGRSPLKGSVQSFTPSPVEYHSPGLISNSPVLSGSYSSGISSLSRCSTSETSGFENQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPIPLPHSLSIPVTS

Predict reactive species
Full Name dedicator of cytokinesis 4
Calculated Molecular Weight 2011 aa, 230 kDa
Observed Molecular Weight 225 kDa
GenBank Accession NumberBC117689
Gene Symbol DOCK4
Gene ID (NCBI) 9732
RRIDAB_3672807
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N1I0
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DOCK4, originally identified as a product of a gene which is deleted during tumor progression, is a member of DOCK180 family proteins. Dock4 has been found recently to be associated with several neuropsychiatric diseases, including autism, dyslexia, and schizophrenia. Multiple studies in fibroblasts then confirmed that Dock4 is capable of controlling cell migration by transducing several upstream signals, such as Wnt, platelet-derived growth factor, and RhoG, toward activation of Rac1. Mutations in this gene have been associated with ovarian, prostate, glioma, and colorectal cancers.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 DOCK4 antibody CL488-27151Download protocol
IF protocol for CL Plus 488 DOCK4 antibody CL488-27151Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...