DOCK7 Polyclonal antibody

DOCK7 Polyclonal Antibody for WB, IF/ICC, IP, ELISA
Cat No. 13000-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, CoIP, ELISA

ZIR2, dedicator of cytokinesis 7

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293T cells, mouse brain tissue, human brain tissue, mouse ovary tissue, Jurkat cells, HeLa cells, HepG2 cells, K-562 cells, rat brain tissue
Positive IP detected inHeLa cells
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13000-1-AP targets DOCK7 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3671

Product name: Recombinant human DOCK7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 447-798 aa of BC016392

Sequence: MAGMYEAVNEVYKVLIPIHEANRDAKKLSTIHGKLQEAFSKIVHQDGKRMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL

Predict reactive species
Full Name dedicator of cytokinesis 7
Calculated Molecular Weight 2109 aa, 239 kDa
Observed Molecular Weight 238-243 kDa
GenBank Accession NumberBC016392
Gene Symbol DOCK7
Gene ID (NCBI) 85440
RRIDAB_10646476
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96N67
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DOCK 7 (dedicator of cytokinesis 7), also known as ZIR2, is a member of the DOCK180-related protein superfamily. Expressed mainly in neuronal cells, DOCK 7 is a guanine nucleotide exchange factor (GEF) for small GTPases, Rac1 and Cdc42, which are the major regulators of actin cytoskeleton. Multiple isoforms of DOCK 7 exist due to alternative splicing events. The DOCK 7 antibody (13000-1-AP) can recognize all the isoforms.

Protocols

Product Specific Protocols
IF protocol for DOCK7 antibody 13000-1-APDownload protocol
IP protocol for DOCK7 antibody 13000-1-APDownload protocol
WB protocol for DOCK7 antibody 13000-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IF

Clin Transl Med

Tumour-associated macrophage-derived DOCK7-enriched extracellular vesicles drive tumour metastasis in colorectal cancer via the RAC1/ABCA1 axis

Authors - Weiwei Chen
  • KD Validated
humanWB

Mol Biol Cell

The WASH complex, an endosomal Arp2/3 activator, interacts with the Hermansky-Pudlak syndrome complex BLOC-1 and its cargo phosphatidylinositol-4-kinase type IIα.

Authors - P V Ryder
mouseWB

Nat Cell Biol

EGFR ligand shifts the role of EGFR from oncogene to tumour suppressor in EGFR-amplified glioblastoma by suppressing invasion through BIN3 upregulation.

Authors - Gao Guo
humanWB,IF,IP,CoIP

Neurobiol Dis

The Warburg micro syndrome protein RAB3GAP1 modulates neuronal morphogenesis and interacts with axon elongation end ER-Golgi trafficking factors

Authors - Pankaj S Ghate
humanWB

Phytomedicine

Protective effect of ethyl ferulate against hypoxic injury in retinal cells and retinal neovascularization in an oxygen-induced retinopathy model

Authors - Rong Xue
humanWB

Front Immunol

Circ_BBS9 as an early diagnostic biomarker for lung adenocarcinoma: direct interaction with IFIT3 in the modulation of tumor immune microenvironment

Authors - Daijun Peng
Loading...
||
New chat Able
正在加载,请稍候...