Featured Product
KD/KO Validated

DOCK7 Polyclonal antibody

DOCK7 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13000-1-AP

Publications(9)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

dedicator of cytokinesis 7, ZIR2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis of HepG2 using 13000-1-AP
WB result of DOCK7 antibody (13000-1-AP; 1:60000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DOCK7 transfected HepG2 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 13000-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 13000-1-AP (DOCK7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 13000-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 13000-1-AP (DOCK7 antibody) at dilution of 1:12000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human brain using 13000-1-AP
human brain tissue were subjected to SDS PAGE followed by western blot with 13000-1-AP (DOCK7 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse ovary using 13000-1-AP
mouse ovary tissue were subjected to SDS PAGE followed by western blot with 13000-1-AP (DOCK7 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse brain using 13000-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 13000-1-AP (DOCK7 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of HeLa using 13000-1-AP
IP result of anti-DOCK7 (IP:13000-1-AP, 4ug; Detection:13000-1-AP 1:10000) with HeLa cells lysate 1280 ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of HeLa using 13000-1-AP
IP result of anti-DOCK7 (IP:13000-1-AP, 4ug; Detection:13000-1-AP 1:1000) with HeLa cells lysate 2640 ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse ovary using 13000-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 13000-1-AP (DOCK7 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse ovary using 13000-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 13000-1-AP (DOCK7 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 13000-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13000-1-AP (DOCK7 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse embryo using 13000-1-AP
Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 13000-1-AP (DOCK7 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse stomach using 13000-1-AP
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 13000-1-AP (DOCK7 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat ovary using 13000-1-AP
Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 13000-1-AP (DOCK7 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 13000-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 13000-1-AP (DOCK7 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse embryo using 13000-1-AP
Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 13000-1-AP (DOCK7 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse stomach using 13000-1-AP
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 13000-1-AP (DOCK7 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat ovary using 13000-1-AP
Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 13000-1-AP (DOCK7 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 13000-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 13000-1-AP (DOCK7 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 13000-1-AP
Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using DOCK7 antibody (13000-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (9)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293T cells, HepG2 cells, human brain tissue, mouse brain tissue, mouse ovary tissue, Jurkat cells, HeLa cells, K-562 cells, rat brain tissue
Positive IP detected in	HeLa cells
Positive IHC detected in	rat stomach tissue, mouse ovary tissue, human placenta tissue, mouse embryo tissue, mouse stomach tissue, rat ovary tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13000-1-AP targets DOCK7 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3671 Product name: Recombinant human DOCK7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 447-798 aa of BC016392 Sequence: MAGMYEAVNEVYKVLIPIHEANRDAKKLSTIHGKLQEAFSKIVHQDGKRMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL Predict reactive species
Full Name	dedicator of cytokinesis 7
Calculated Molecular Weight	2109 aa, 239 kDa
Observed Molecular Weight	238-243 kDa
GenBank Accession Number	BC016392
Gene Symbol	DOCK7
Gene ID (NCBI)	85440
RRID	AB_10646476
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q96N67
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DOCK 7 (dedicator of cytokinesis 7), also known as ZIR2, is a member of the DOCK180-related protein superfamily. Expressed mainly in neuronal cells, DOCK 7 is a guanine nucleotide exchange factor (GEF) for small GTPases, Rac1 and Cdc42, which are the major regulators of actin cytoskeleton. Multiple isoforms of DOCK 7 exist due to alternative splicing events. The DOCK 7 antibody (13000-1-AP) can recognize all the isoforms.

Protocols

Product Specific Protocols
IF protocol for DOCK7 antibody 13000-1-AP	Download protocol
IP protocol for DOCK7 antibody 13000-1-AP	Download protocol
WB protocol for DOCK7 antibody 13000-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
mouse	WB	Nat Cell Biol EGFR ligand shifts the role of EGFR from oncogene to tumour suppressor in EGFR-amplified glioblastoma by suppressing invasion through BIN3 upregulation. Authors - Gao Guo View Article
human	WB	Research (Wash D C) CCN5 Drives Leydig Cell Aging and Testicular Dysfunction: Insights into Fibrosis, Lipid Dysregulation, and Therapeutic Potential Authors - Xiaoli Tan View Article
human	WB	Phytomedicine Protective effect of ethyl ferulate against hypoxic injury in retinal cells and retinal neovascularization in an oxygen-induced retinopathy model Authors - Rong Xue View Article
mouse	WB,IF	Clin Transl Med Tumour-associated macrophage-derived DOCK7-enriched extracellular vesicles drive tumour metastasis in colorectal cancer via the RAC1/ABCA1 axis Authors - Weiwei Chen KD Validated View Article
human	WB	Front Immunol Circ_BBS9 as an early diagnostic biomarker for lung adenocarcinoma: direct interaction with IFIT3 in the modulation of tumor immune microenvironment Authors - Daijun Peng View Article
human	WB,IP,IF,CoIP	Neurobiol Dis The Warburg micro syndrome protein RAB3GAP1 modulates neuronal morphogenesis and interacts with axon elongation end ER-Golgi trafficking factors Authors - Pankaj S Ghate View Article