DOCK7 Monoclonal antibody, PBS Only

• 

  WB analysis using 67842-1-Ig (same clone as 67842-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67842-1-Ig (DOCK7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67842-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67842-1-Ig (same clone as 67842-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67842-1-Ig (DOCK7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67842-1-PBS in a different storage buffer formulation.

DOCK7 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67842-1-PBS

Clone No.1A4A6

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

dedicator of cytokinesis 7, DOCK7, KIAA1771, ZIR2

---

Product Information

67842-1-PBS targets DOCK7 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28417

  Product name: Recombinant human DOCK7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 447-798 aa of BC016392

  Sequence: MAGMYEAVNEVYKVLIPIHEANRDAKKLSTIHGKLQEAFSKIVHQDGKRMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL

• Full Name: dedicator of cytokinesis 7
• Calculated Molecular Weight: 2109 aa, 239 kDa
• Observed Molecular Weight: 243 kDa
• GenBank Accession Number: BC016392
• Gene Symbol: DOCK7
• Gene ID (NCBI): 85440
• RRID: AB_2918604
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96N67
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DOCK 7 (dedicator of cytokinesis 7), also known as ZIR2, is a member of the DOCK180-related protein superfamily. Expressed mainly in neuronal cells, DOCK 7 is a guanine nucleotide exchange factor (GEF) for small GTPases, Rac1 and Cdc42, which are the major regulators of actin cytoskeleton. Multiple isoforms of DOCK 7 exist due to alternative splicing events.