• Featured Product
  • KD/KO Validated

DOCK8 Polyclonal antibody

DOCK8 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 11622-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

dedicator of cytokinesis 8, MRD2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, rat lung tissue, THP-1 cells
Positive IHC detected inrat lung tissue, human heart tissue, mouse kidney tissue, mouse lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11622-1-AP targets DOCK8 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2040

Product name: Recombinant human DOCK8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 257-606 aa of BC019102

Sequence: EVYKLVIPILEAHREFRKLTLTHSKLQRAFDSIVNKDHKRMFGTYFRVGFFGSKFGDLDEQEFVYKEPAITKLPEISHRLEAFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLTTMHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQREYQQELKKNYNKLKENLRPMIERKIPELYKPIFRVESQKRDSFHRSSFRKCETQLSQGS

Predict reactive species
Full Name dedicator of cytokinesis 8
Calculated Molecular Weight 2031 aa, 231 kDa
Observed Molecular Weight 230-239 kDa
GenBank Accession NumberBC019102
Gene Symbol DOCK8
Gene ID (NCBI) 81704
RRIDAB_10216360
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8NF50
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Background

Dedicator of Cytokinesis 8 (DOCK8) is a protein that regulates the actin cytoskeleton, with particular importance in immune cells and a key role in innate and adaptive immune responses.

 What is the molecular weight of DOCK8?

231 kDa. DOCK8 is a protein composed of 2031 amino acids and is a guanine nucleotide exchange factor (GEF).

 What is the function of DOCK8?

DOCK8 is a member of the DOCK family of proteins, which have a unique DRH2 domain enabling them to act as GEFs and so controlling a range of cellular processes in various signaling pathways (PMID: 12432077). The specific target of DOCK8 is Cell division control protein 42 homolog (Cdc42), a small GTPase that is involved in regulation of the cell cycle and forms a complex. DOCK8 also acts as a scaffold molecule in this complex that initiates actin polymerization via the Wiskott-Aldrich Syndrome protein (WASp) (PubMed: 28028151, PubMed: 22461490).

 What diseases are associated with DOCK8?

The role of DOCK8 in immunity was first identified with the study of DOCK8-deficient patients who presented with combined immunodeficiency (PMID: 19776401; PMID: 20004785). The subsequent study of DOCK8 in immune cells such as T cells, natural killer (NK) cells, and B cells has revealed how it regulates their normal function. This includes the regulation of immune synapse formation, immune cell trafficking, regulation of dendritic cell polarization, and cytokine production (PMID: 28366940).

DOCK8 deficiency is caused by a number of different mutations in the gene. It leads to the autosomal recessive form of the immunodeficiency disease Hyper-IgE syndrome, or Job's syndrome. The symptoms of DOCK8 deficiency include eczema, high levels of serum IgE, hypereosinophilia, and recurrent respiratory and skin infections as a result of impaired immune cell function. 


Protocols

Product Specific Protocols
IHC protocol for DOCK8 antibody 11622-1-APDownload protocol
WB protocol for DOCK8 antibody 11622-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Immunol

Heme drives hemolysis-induced susceptibility to infection via disruption of phagocyte functions.

Authors - Rui Martins
  • KO Validated
mouseIF

Cell Death Differ

CCL2 regulation of MST1-mTOR-STAT1 signaling axis controls BCR signaling and B-cell differentiation.

Authors - Lu Yang
mouseWB

Diabetes

Dedicator of Cytokinesis 5 Regulates Keratinocyte Function and Promotes Diabetic Wound Healing.

Authors - Hua Qu
humanWB,IP,IF

Oncotarget

CD147 promotes Src-dependent activation of Rac1 signaling through STAT3/DOCK8 during the motility of hepatocellular carcinoma cells.

Authors - Shi-Jie Wang
  • KD Validated
humanWB

iScience

DOCK8-expressing T follicular helper cells newly generated beyond self-organized criticality cause systemic lupus erythematosus.

Authors - Shunichi Shiozawa
  • KO Validated
mouseWB

J Alzheimers Dis

A novel finding relates to the involvement of ATF3/DOCK8 in Alzheimer's disease pathogenesis

Authors - Wenqiang Zhang
Loading...
||
New chat

Able

正在加载,请稍候...