DOLPP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DOLPP1 Polyclonal antibody (34200-1-AP)

• 

  WB analysis using 34200-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34200-1-AP (DOLPP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 34200-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 34200-1-AP (DOLPP1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human urothelial carcinoma using 34200-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 34200-1-AP (DOLPP1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 34200-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using DOLPP1 antibody (34200-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of U2OS using 34200-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using DOLPP1 antibody (34200-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

DOLPP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 34200-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Dolichyl pyrophosphate phosphatase 1, Dolichyldiphosphatase 1, EC:3.6.1.43, LSFR2

---

Tested Applications

• Positive WB detected in: LNCaP cells, MCF-7 cells, MDA-MB-231 cells, RKO cells
• Positive IHC detected in: human urothelial carcinoma tissue, human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells, A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34200-1-AP targets DOLPP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40783

  Product name: Recombinant human DOLPP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 183-238 aa of BC033686

  Sequence: TQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ

• Full Name: dolichyl pyrophosphate phosphatase 1
• Calculated Molecular Weight: 238 aa, 27 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC033686
• Gene Symbol: DOLPP1
• Gene ID (NCBI): 57171
• RRID: AB_3743171
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86YN1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DOLPP1 (Dolichyl Pyrophosphate Phosphatase 1) is a multiple-pass transmembrane protein localized to the endoplasmic reticulum membrane and serves as a key regulatory enzyme in the N-glycosylation pathway. This enzyme catalyzes the dephosphorylation of dolichyl pyrophosphate (Dol-PP) to generate dolichyl phosphate (Dol-P), thereby facilitating the recycling of glycosyl carrier lipids, which is essential for maintaining N-glycosylation efficiency and optimal levels of lipid-linked oligosaccharides (LLO). Deficiency of DOLPP1 leads to the accumulation of Dol-PP and depletion of Dol-P, resulting in protein glycosylation defects and endoplasmic reticulum stress. Studies have shown that DOLPP1 forms a functional network with glycosylation-related proteins such as MPDU1 and DPM1/2/3, participating in metabolic disorders associated with congenital disorders of glycosylation (CDG), and acts as an important regulator of the cellular secretory pathway and protein quality control.