DOM3Z Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DOM3Z Polyclonal antibody (11015-2-AP)

• Featured Product
• KD/KO Validated

DOM3Z Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 11015-2-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

Synonyms

5'-3' exoribonuclease DXO, Decapping and exoribonuclease protein, DeNADding enzyme DXO, DOM 3Z, Dom-3 homolog Z

• 

  WB analysis using 11015-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11015-2-AP (DOM3Z antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 11015-2-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11015-2-AP (DOM3Z antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 11015-2-AP

  IP result of anti-DOM3Z (IP:11015-2-AP, 4ug; Detection:11015-2-AP 1:300) with mouse testis tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 11015-2-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DOM3Z antibody (11015-2-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-Phalloidin (green).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: MCF-7 cells, mouse testis tissue
• Positive IP detected in: mouse testis tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11015-2-AP targets DOM3Z in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1491

  Product name: Recombinant human DOM3Z protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-396 aa of BC009344

  Sequence: MDPRGTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDLRDGYPDRYQPRDEEVQERLDHLLCWLLEHRGRLEGGPGWLAEAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPNARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLGSHPLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPNVVAGFRNPDGFVSSLKTFPTMKMFEYVRNDRDGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHQDAPYAFLPIWYVEAMTQDLPSPPKTPSPK

• Full Name: dom-3 homolog Z (C. elegans)
• Calculated Molecular Weight: 43.6 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC009344
• Gene Symbol: DOM3Z
• Gene ID (NCBI): 1797
• RRID: AB_2095257
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O77932
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DOM3Z also known as DXO, NG6, is a 396 amino acid ubiquitously expressed protein. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and possesses RNA 5'-pyrophosphohydrolase activity. Chromosome 6 contains 170 million base pairs and represents nearly 6% of the human genome. Partial deletion of the q arm of chromosome 6 is associated with early-onset colorectal cancer. DOM3Z is ubiquitously expressed, with high expression in the testis (PMID: 9799600).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; 5' End Nicotinamide Adenine Dinucleotide Cap in Human Cells Promotes RNA Decay through DXO-Mediated deNADding.; Authors - Xinfu Jiao ; KO Validated
human	WB	Mol Cell; A mammalian pre-mRNA 5' end capping quality control mechanism and an unexpected link of capping to pre-mRNA processing.; Authors - Xinfu Jiao ; KD Validated
human	WB,IF	RNA; Unraveling regulation and new components of human P-bodies through a protein interaction framework and experimental validation.; Authors - Zheng Dinghai D
human	IF	PLoS One; 2'-O-methylation of the mRNA cap protects RNAs from decapping and degradation by DXO.; Authors - Frédéric Picard-Jean
human	WB	Nat Chem Biol; Structural and mechanistic basis of mammalian Nudt12 RNA deNADding.; Authors - Ewa Grudzien-Nogalska ; KO Validated